Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Claudin-4 (CLDN4) -VLPs (Active)

Product Specifications

Product Name Alternative

(Clostridium perfringens enterotoxin receptor) (CPE-R) (CPE-receptor) (Williams-Beuren syndrome chromosomal region 8 protein)

Abbreviation

Recombinant Human CLDN4 protein-VLPs (Active)

Gene Name

CLDN4

UniProt

O14493

Expression Region

1-209aa

Organism

Homo sapiens (Human)

Target Sequence

MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV

Tag

C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)

Type

MP-VLP Transmembrane Protein & Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Channel-forming tight junction protein that mediates paracellular chloride transport in the kidney. Plays a critical role in the paracellular reabsorption of filtered chloride in the kidney collecting ducts. Claudins play a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

The purity information is not available for VLPs proteins.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human CLDN4 at 5 μg/mL can bind Anti-CLDN4 recombinant antibody (CSB-RA005506MA1HU), the EC50 is 29.56-50.75 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

Molecular Weight

23.4 kDa

References & Citations

"Claudin association with CD81 defines hepatitis C virus entry." Harris H.J., Davis C., Mullins J.G., Hu K., Goodall M., Farquhar M.J., Mee C.J., McCaffrey K., Young S., Drummer H., Balfe P., McKeating J.A. J. Biol. Chem. 285:21092-21102 (2010)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bartonella tribocorum Glutamate--tRNA ligase 1 (gltX1)
MBS1190820-01 0.02 mg (E-Coli)

Recombinant Bartonella tribocorum Glutamate--tRNA ligase 1 (gltX1)

Sign In for Pricing
View Details
Recombinant Bartonella tribocorum Glutamate--tRNA ligase 1 (gltX1)
MBS1190820-02 0.02 mg (Yeast)

Recombinant Bartonella tribocorum Glutamate--tRNA ligase 1 (gltX1)

Sign In for Pricing
View Details
Recombinant Bartonella tribocorum Glutamate--tRNA ligase 1 (gltX1)
MBS1190820-03 0.1 mg (E-Coli)

Recombinant Bartonella tribocorum Glutamate--tRNA ligase 1 (gltX1)

Sign In for Pricing
View Details
Recombinant Bartonella tribocorum Glutamate--tRNA ligase 1 (gltX1)
MBS1190820-04 0.1 mg (Yeast)

Recombinant Bartonella tribocorum Glutamate--tRNA ligase 1 (gltX1)

Sign In for Pricing
View Details
Recombinant Bartonella tribocorum Glutamate--tRNA ligase 1 (gltX1)
MBS1190820-05 0.02 mg (Baculovirus)

Recombinant Bartonella tribocorum Glutamate--tRNA ligase 1 (gltX1)

Sign In for Pricing
View Details
Recombinant Bartonella tribocorum Glutamate--tRNA ligase 1 (gltX1)
MBS1190820-06 0.02 mg (Mammalian-Cell)

Recombinant Bartonella tribocorum Glutamate--tRNA ligase 1 (gltX1)

Sign In for Pricing
View Details