Animal-Free IGF-I/IGF-1, Human (His)
The LR3 IGF-I/IGF-1 protein is similar to insulin and has potent growth-promoting activity that exceeds the efficacy of insulin. As a potential physiological regulator, it stimulates glucose transport and glycogen synthesis in osteoblasts even at significantly lower concentrations than insulin. Animal-Free IGF-I/IGF-1 Protein, Human (His) is the recombinant human-derived animal-FreeIGF-I/IGF-1 protein, expressed by E. coli , with C-His labeled tag.This product is for cell culture use only.
Product Specifications
Product Name Alternative
Animal-Free IGF-I/IGF-1 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/animal-free-igf-i-igf-1-protein-human-his.html
Purity
95.0
Smiles
MGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Molecular Formula
3479 (Gene_ID) P05019-1 (G49-A118) (Accession)
Molecular Weight
Approximately 8-10 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
CD44 Standard (156-3C11), CF488A conjugate, 0.1mg/mL
Insulin (2D11-H5), CF647 conjugate, 0.1mg/mL
Tyrosinase (T311), CF594 conjugate, 0.1mg/mL
CD59 (heavy chain of Protectin) (BRA-10G), CF568 conjugate, 0.1mg/mL
