Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IGF-I/IGF-1, Human (His)

The LR3 IGF-I/IGF-1 protein is similar to insulin and has potent growth-promoting activity that exceeds the efficacy of insulin. As a potential physiological regulator, it stimulates glucose transport and glycogen synthesis in osteoblasts even at significantly lower concentrations than insulin. Animal-Free IGF-I/IGF-1 Protein, Human (His) is the recombinant human-derived animal-FreeIGF-I/IGF-1 protein, expressed by E. coli , with C-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IGF-I/IGF-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-igf-i-igf-1-protein-human-his.html

Purity

95.0

Smiles

MGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Molecular Formula

3479 (Gene_ID) P05019-1 (G49-A118) (Accession)

Molecular Weight

Approximately 8-10 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RHBDD3 Peptide - C-terminal region
orb2001408 100 µg

RHBDD3 Peptide - C-terminal region

Sign In for Pricing
View Details
Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (KRT16/1714), CF488A conjugate, 0.1mg/mL
BNC881714-100 1x 100 µL

Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (KRT16/1714), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Anti-Mouse CD276/B7-H3 Antibody (MJ18), FITC
MV612117-01 1 Each

Anti-Mouse CD276/B7-H3 Antibody (MJ18), FITC

Sign In for Pricing
View Details
Anti-Mouse CD276/B7-H3 Antibody (MJ18), FITC
MV612117-02 100 Tests

Anti-Mouse CD276/B7-H3 Antibody (MJ18), FITC

Sign In for Pricing
View Details
Rabbit anti-Shigella flexneri YJEI Polyclonal Antibody
MBS7166337 Inquire

Rabbit anti-Shigella flexneri YJEI Polyclonal Antibody

Sign In for Pricing
View Details
Ring Finger Protein 219 (RNF219) Antibody (Biotin)
abx337524-01 20 µg

Ring Finger Protein 219 (RNF219) Antibody (Biotin)

Sign In for Pricing
View Details