Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free GDNF, Mouse (His)

Glial-cell-line-derived neurotrophic factor (GDNF), a neurotrophic factor belongs to the GDNF family ligands (GFLs) ., promotes survival of dopamine neurons. GDNF demonstrates a variety of neuroprotective roles for mammalian neurons[1]. Animal-Free GDNF Protein, Mouse (His), a recombinant animal-free protein, is produced in E.coil with a C-Terminal His-tag. It consists of 134 amino acids (S78-I211) .This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free GDNF Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-gdnf-protein-mouse-his.html

Purity

98.0

Smiles

MSPDKQAAALPRRERNRQAAAASPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCESAETMYDKILKNLSRSRRLTSDKVGQACCRPVAFDDDLSFLDDNLVYHILRKHSAKRCGCI

Molecular Formula

14573 (Gene_ID) P48540 (S78-I211) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Alberto F Cintrón-Colón, et al. GDNF synthesis, signaling, and retrograde transport in motor neurons. Cell Tissue Res. 2020 Oct;382 (1) :47-56.|[2]Tomac A, et al. Protection and repair of the nigrostriatal dopaminergic system by GDNF in vivo. Nature.1995;373 (6512) : 335-339.|[3]Hannu Sariola, et al. GDNF maintains mouse spermatogonial stem cells in vivo and in vitro. Methods Mol Biol. 2008;450:127-35.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal PRPF8 Antibody [DyLight 755]
NBP2-22272IR 0.1 mL

Rabbit Polyclonal PRPF8 Antibody [DyLight 755]

Sign In for Pricing
View Details
RABGAP1L CRISPRa sgRNA lentivector (set of three targets)(Mouse)
38381124 3x 1.0µg DNA

RABGAP1L CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
MARCH1, ID (MARCH1, RNF171, E3 ubiquitin-protein ligase MARCH1, Membrane-associated RING finger protein 1, Membrane-associated RING-CH protein I, RING finger protein 171) (Azide free) (HRP) discontinued
038192-HRP 200 µL

MARCH1, ID (MARCH1, RNF171, E3 ubiquitin-protein ligase MARCH1, Membrane-associated RING finger protein 1, Membrane-associated RING-CH protein I, RING finger protein 171) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
(R) -4-Methyl Ketoprofen-d3
463862 1 mg

(R) -4-Methyl Ketoprofen-d3

Sign In for Pricing
View Details
ELISA kit for Mouse Protein delta homolog 1 (DLK1)
KTE71250-01 48 Tests

ELISA kit for Mouse Protein delta homolog 1 (DLK1)

Sign In for Pricing
View Details
ELISA kit for Mouse Protein delta homolog 1 (DLK1)
KTE71250-02 96 Tests

ELISA kit for Mouse Protein delta homolog 1 (DLK1)

Sign In for Pricing
View Details