Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free GDNF, Mouse (His)

Glial-cell-line-derived neurotrophic factor (GDNF), a neurotrophic factor belongs to the GDNF family ligands (GFLs) ., promotes survival of dopamine neurons. GDNF demonstrates a variety of neuroprotective roles for mammalian neurons[1]. Animal-Free GDNF Protein, Mouse (His), a recombinant animal-free protein, is produced in E.coil with a C-Terminal His-tag. It consists of 134 amino acids (S78-I211) .This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free GDNF Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-gdnf-protein-mouse-his.html

Purity

98.0

Smiles

MSPDKQAAALPRRERNRQAAAASPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCESAETMYDKILKNLSRSRRLTSDKVGQACCRPVAFDDDLSFLDDNLVYHILRKHSAKRCGCI

Molecular Formula

14573 (Gene_ID) P48540 (S78-I211) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Alberto F Cintrón-Colón, et al. GDNF synthesis, signaling, and retrograde transport in motor neurons. Cell Tissue Res. 2020 Oct;382 (1) :47-56.|[2]Tomac A, et al. Protection and repair of the nigrostriatal dopaminergic system by GDNF in vivo. Nature.1995;373 (6512) : 335-339.|[3]Hannu Sariola, et al. GDNF maintains mouse spermatogonial stem cells in vivo and in vitro. Methods Mol Biol. 2008;450:127-35.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human MUCL1 Protein, His (Fc)-Avi-tagged
MUCL1-3545H 50 µg

Recombinant Human MUCL1 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
PIK3C2A (19D6) Mouse Monoclonal antibody
E28PE1607 100 µL

PIK3C2A (19D6) Mouse Monoclonal antibody

Sign In for Pricing
View Details
PTPRN2 (Protein Tyrosine Phosphatase, Receptor Type, N Polypeptide 2, IA-2beta, IAR, ICAAR, PTPRP) (MaxLight 550)
250707-ML550 100 µL

PTPRN2 (Protein Tyrosine Phosphatase, Receptor Type, N Polypeptide 2, IA-2beta, IAR, ICAAR, PTPRP) (MaxLight 550)

Sign In for Pricing
View Details
Lentiviral mouse Manea shRNA (UAS) - Lentiviral mouseManea shRNA (UAS, GFP) (25)
GTR15232460 1 Vial

Lentiviral mouse Manea shRNA (UAS) - Lentiviral mouseManea shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Recombinant Salivary Alpha Amylase (AMY1A)
SIPB133Hu02-01 10 µg

Recombinant Salivary Alpha Amylase (AMY1A)

Sign In for Pricing
View Details
Recombinant Salivary Alpha Amylase (AMY1A)
SIPB133Hu02-02 50 µg

Recombinant Salivary Alpha Amylase (AMY1A)

Sign In for Pricing
View Details