Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free GDNF, Mouse (His)

Glial-cell-line-derived neurotrophic factor (GDNF), a neurotrophic factor belongs to the GDNF family ligands (GFLs) ., promotes survival of dopamine neurons. GDNF demonstrates a variety of neuroprotective roles for mammalian neurons[1]. Animal-Free GDNF Protein, Mouse (His), a recombinant animal-free protein, is produced in E.coil with a C-Terminal His-tag. It consists of 134 amino acids (S78-I211) .This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free GDNF Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-gdnf-protein-mouse-his.html

Purity

98.0

Smiles

MSPDKQAAALPRRERNRQAAAASPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCESAETMYDKILKNLSRSRRLTSDKVGQACCRPVAFDDDLSFLDDNLVYHILRKHSAKRCGCI

Molecular Formula

14573 (Gene_ID) P48540 (S78-I211) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Alberto F Cintrón-Colón, et al. GDNF synthesis, signaling, and retrograde transport in motor neurons. Cell Tissue Res. 2020 Oct;382 (1) :47-56.|[2]Tomac A, et al. Protection and repair of the nigrostriatal dopaminergic system by GDNF in vivo. Nature.1995;373 (6512) : 335-339.|[3]Hannu Sariola, et al. GDNF maintains mouse spermatogonial stem cells in vivo and in vitro. Methods Mol Biol. 2008;450:127-35.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp938 ORF Vector (Mouse) (pORF)
51186014 1.0 µg DNA

Zfp938 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Human RB11B ELISA Kit
E105200 1 Each

Human RB11B ELISA Kit

Sign In for Pricing
View Details
Fert2 Protein Vector (Rat) (pPM-C-HA)
PV268280 500 ng

Fert2 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
TRNAV29 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
48448111 3x 1.0 µg

TRNAV29 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Rabbit Polyclonal Cip4 Antibody [DyLight 550]
NB100-59833R 0.1 mL

Rabbit Polyclonal Cip4 Antibody [DyLight 550]

Sign In for Pricing
View Details
Ablim2 (NM_001177698) Mouse Tagged ORF Clone Lentiviral Particle
MR223681L4V 200 µL

Ablim2 (NM_001177698) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details