Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free GDNF, Mouse (His)

Glial-cell-line-derived neurotrophic factor (GDNF), a neurotrophic factor belongs to the GDNF family ligands (GFLs) ., promotes survival of dopamine neurons. GDNF demonstrates a variety of neuroprotective roles for mammalian neurons[1]. Animal-Free GDNF Protein, Mouse (His), a recombinant animal-free protein, is produced in E.coil with a C-Terminal His-tag. It consists of 134 amino acids (S78-I211) .This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free GDNF Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-gdnf-protein-mouse-his.html

Purity

98.0

Smiles

MSPDKQAAALPRRERNRQAAAASPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCESAETMYDKILKNLSRSRRLTSDKVGQACCRPVAFDDDLSFLDDNLVYHILRKHSAKRCGCI

Molecular Formula

14573 (Gene_ID) P48540 (S78-I211) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Alberto F Cintrón-Colón, et al. GDNF synthesis, signaling, and retrograde transport in motor neurons. Cell Tissue Res. 2020 Oct;382 (1) :47-56.|[2]Tomac A, et al. Protection and repair of the nigrostriatal dopaminergic system by GDNF in vivo. Nature.1995;373 (6512) : 335-339.|[3]Hannu Sariola, et al. GDNF maintains mouse spermatogonial stem cells in vivo and in vitro. Methods Mol Biol. 2008;450:127-35.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine (Canine Hepatitis Virus/Parvovirus/Distemper Virus)   3X antibody Test Card
F11364 15T

Canine (Canine Hepatitis Virus/Parvovirus/Distemper Virus) 3X antibody Test Card

Sign In for Pricing
View Details
4,5-Diamino-6-chloropyrimidine
TRC-D416275-2.5G 2.5 g

4,5-Diamino-6-chloropyrimidine

Sign In for Pricing
View Details
Rabbit Monoclonal Cytokeratin 1/10 Antibody (KRT10/1990R) [Alexa Fluor 488]
NBP2-75768AF488 0.1 mL

Rabbit Monoclonal Cytokeratin 1/10 Antibody (KRT10/1990R) [Alexa Fluor 488]

Sign In for Pricing
View Details
PARP2 Human qPCR Primer Pair (NM_005484)
HP234472 200 Reactions

PARP2 Human qPCR Primer Pair (NM_005484)

Sign In for Pricing
View Details
TEKT5 (NM_144674) Human Untagged Clone
SC306179 10 µg

TEKT5 (NM_144674) Human Untagged Clone

Sign In for Pricing
View Details
FLCN (NM_144606) Human Over-expression Lysate
LC403410 20 µg

FLCN (NM_144606) Human Over-expression Lysate

Sign In for Pricing
View Details