Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free GDNF, Mouse (His)

Glial-cell-line-derived neurotrophic factor (GDNF), a neurotrophic factor belongs to the GDNF family ligands (GFLs) ., promotes survival of dopamine neurons. GDNF demonstrates a variety of neuroprotective roles for mammalian neurons[1]. Animal-Free GDNF Protein, Mouse (His), a recombinant animal-free protein, is produced in E.coil with a C-Terminal His-tag. It consists of 134 amino acids (S78-I211) .This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free GDNF Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-gdnf-protein-mouse-his.html

Purity

98.0

Smiles

MSPDKQAAALPRRERNRQAAAASPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCESAETMYDKILKNLSRSRRLTSDKVGQACCRPVAFDDDLSFLDDNLVYHILRKHSAKRCGCI

Molecular Formula

14573 (Gene_ID) P48540 (S78-I211) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Alberto F Cintrón-Colón, et al. GDNF synthesis, signaling, and retrograde transport in motor neurons. Cell Tissue Res. 2020 Oct;382 (1) :47-56.|[2]Tomac A, et al. Protection and repair of the nigrostriatal dopaminergic system by GDNF in vivo. Nature.1995;373 (6512) : 335-339.|[3]Hannu Sariola, et al. GDNF maintains mouse spermatogonial stem cells in vivo and in vitro. Methods Mol Biol. 2008;450:127-35.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLK4 Protein Vector (Human) (pPB-C-His)
PV009833 500 ng

CLK4 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
C12orf4 Recombinant Protein (Human)
RP003619 100 µg

C12orf4 Recombinant Protein (Human)

Sign In for Pricing
View Details
ZBTB20 Protein Vector (Human) (pPB-C-His)
PV046841 500 ng

ZBTB20 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
CD90.2 (Thy1.2, Thy 1b) (APC) discontinued
C2441-05A-APC 200 µL

CD90.2 (Thy1.2, Thy 1b) (APC) discontinued

Sign In for Pricing
View Details
Lentiviral mouse Slc35e3 shRNA (UAS) - Lentiviral mouse Slc35e3 shRNA (UAS, GFP) plasmid
GTR15150790 1 Vial

Lentiviral mouse Slc35e3 shRNA (UAS) - Lentiviral mouse Slc35e3 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
CT45A4 sgRNA CRISPR Lentivector (Human) (Target 3)
K0521804 1.0 µg DNA

CT45A4 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details