Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free GDNF, Mouse (His)

Glial-cell-line-derived neurotrophic factor (GDNF), a neurotrophic factor belongs to the GDNF family ligands (GFLs) ., promotes survival of dopamine neurons. GDNF demonstrates a variety of neuroprotective roles for mammalian neurons[1]. Animal-Free GDNF Protein, Mouse (His), a recombinant animal-free protein, is produced in E.coil with a C-Terminal His-tag. It consists of 134 amino acids (S78-I211) .This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free GDNF Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-gdnf-protein-mouse-his.html

Purity

98.0

Smiles

MSPDKQAAALPRRERNRQAAAASPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCESAETMYDKILKNLSRSRRLTSDKVGQACCRPVAFDDDLSFLDDNLVYHILRKHSAKRCGCI

Molecular Formula

14573 (Gene_ID) P48540 (S78-I211) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Alberto F Cintrón-Colón, et al. GDNF synthesis, signaling, and retrograde transport in motor neurons. Cell Tissue Res. 2020 Oct;382 (1) :47-56.|[2]Tomac A, et al. Protection and repair of the nigrostriatal dopaminergic system by GDNF in vivo. Nature.1995;373 (6512) : 335-339.|[3]Hannu Sariola, et al. GDNF maintains mouse spermatogonial stem cells in vivo and in vitro. Methods Mol Biol. 2008;450:127-35.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human AP3B1 sgRNA gene knockout kit - Lentiviral human AP3B1 sgRNA gene knockout kit (plasmid)
GTR15399758 1 Vial

Lentiviral human AP3B1 sgRNA gene knockout kit - Lentiviral human AP3B1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Tyrosol (Tyr) BioAssayTM ELISA Kit (General)
517740 96 Tests

Tyrosol (Tyr) BioAssayTM ELISA Kit (General)

Sign In for Pricing
View Details
Lentiviral human FZR1 shRNA (UAS) - Lentiviral human FZR1 shRNA (UAS, RFP) (25)
GTR15325274 1 Vial

Lentiviral human FZR1 shRNA (UAS) - Lentiviral human FZR1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Phospho-c-Kit (Tyr721) Polyclonal Antibody
bs-5401R 100 µL

Phospho-c-Kit (Tyr721) Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human JPH3 shRNA (UAS) - Lentiviral human JPH3 shRNA (UAS) (25)
GTR15322448 1 Vial

Lentiviral human JPH3 shRNA (UAS) - Lentiviral human JPH3 shRNA (UAS) (25)

Sign In for Pricing
View Details
Lipopolysaccharides (LPS)
L9170 1 mg

Lipopolysaccharides (LPS)

Sign In for Pricing
View Details