Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free GDNF, Mouse (His)

Glial-cell-line-derived neurotrophic factor (GDNF), a neurotrophic factor belongs to the GDNF family ligands (GFLs) ., promotes survival of dopamine neurons. GDNF demonstrates a variety of neuroprotective roles for mammalian neurons[1]. Animal-Free GDNF Protein, Mouse (His), a recombinant animal-free protein, is produced in E.coil with a C-Terminal His-tag. It consists of 134 amino acids (S78-I211) .This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free GDNF Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-gdnf-protein-mouse-his.html

Purity

98.0

Smiles

MSPDKQAAALPRRERNRQAAAASPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCESAETMYDKILKNLSRSRRLTSDKVGQACCRPVAFDDDLSFLDDNLVYHILRKHSAKRCGCI

Molecular Formula

14573 (Gene_ID) P48540 (S78-I211) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Alberto F Cintrón-Colón, et al. GDNF synthesis, signaling, and retrograde transport in motor neurons. Cell Tissue Res. 2020 Oct;382 (1) :47-56.|[2]Tomac A, et al. Protection and repair of the nigrostriatal dopaminergic system by GDNF in vivo. Nature.1995;373 (6512) : 335-339.|[3]Hannu Sariola, et al. GDNF maintains mouse spermatogonial stem cells in vivo and in vitro. Methods Mol Biol. 2008;450:127-35.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal C1D Antibody
NBP2-48673-25ul 25 µL

Rabbit Polyclonal C1D Antibody

Sign In for Pricing
View Details
Recombinant Anaeromyxobacter sp. Dihydrodipicolinate reductase (dapB)
MBS1182070-01 0.02 mg (E-Coli)

Recombinant Anaeromyxobacter sp. Dihydrodipicolinate reductase (dapB)

Sign In for Pricing
View Details
Recombinant Anaeromyxobacter sp. Dihydrodipicolinate reductase (dapB)
MBS1182070-02 0.02 mg (Yeast)

Recombinant Anaeromyxobacter sp. Dihydrodipicolinate reductase (dapB)

Sign In for Pricing
View Details
Recombinant Anaeromyxobacter sp. Dihydrodipicolinate reductase (dapB)
MBS1182070-03 0.1 mg (E-Coli)

Recombinant Anaeromyxobacter sp. Dihydrodipicolinate reductase (dapB)

Sign In for Pricing
View Details
Recombinant Anaeromyxobacter sp. Dihydrodipicolinate reductase (dapB)
MBS1182070-04 0.1 mg (Yeast)

Recombinant Anaeromyxobacter sp. Dihydrodipicolinate reductase (dapB)

Sign In for Pricing
View Details
Recombinant Anaeromyxobacter sp. Dihydrodipicolinate reductase (dapB)
MBS1182070-05 0.02 mg (Baculovirus)

Recombinant Anaeromyxobacter sp. Dihydrodipicolinate reductase (dapB)

Sign In for Pricing
View Details