Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Peptidyl-prolyl cis-trans isomerase A/CYPA, Human (solution)

CYPA protein, a peptidyl prolyl cis-trans isomerase, has proinflammatory activity by stimulating activation of NF-kappa-B and ERK, JNK, and p38 MAP kinases. It may act as a mediator between the human SARS coronavirus nucleoprotein and BSG/CD147 during the virus' invasion of host cells. Peptidyl-prolyl cis-trans isomerase A/CYPA Protein, Human (solution) is the recombinant human-derived Peptidyl-prolyl cis-trans isomerase A/CYPA protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

Peptidyl-prolyl cis-trans isomerase A/CYPA Protein, Human (solution), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/peptidyl-prolyl-cis-trans-isomerase-a-cypa-protein-human.html

Purity

99.69

Smiles

MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE

Molecular Formula

5478 (Gene_ID) P62937-1 (M1-E165) (Accession)

Molecular Weight

Approximately 16-18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRKD1/PKC mu Rabbit Polyclonal Antibody (APC-Cy7)
orb2452696 100 µL

PRKD1/PKC mu Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
DISC1 (NM_001164540) Human Untagged Clone
SC327196 10 µg

DISC1 (NM_001164540) Human Untagged Clone

Sign In for Pricing
View Details
Elastase 3A (CELA3A) Human Gene Knockout Kit (CRISPR)
KN403249 1 Kit

Elastase 3A (CELA3A) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RPL7AP54 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV775438 1.0 µg DNA

RPL7AP54 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Recombinant Human G-protein coupled bile acid receptor 1 (GPBAR1), partial
CSB-EP819471HU1-01 20 µg

Recombinant Human G-protein coupled bile acid receptor 1 (GPBAR1), partial

Sign In for Pricing
View Details
Recombinant Human G-protein coupled bile acid receptor 1 (GPBAR1), partial
CSB-EP819471HU1-02 100 µg

Recombinant Human G-protein coupled bile acid receptor 1 (GPBAR1), partial

Sign In for Pricing
View Details