Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 6A G-protein coupled receptor homolog U12 (U12)

Product Specifications

Abbreviation

Recombinant Human herpesvirus 6A G-protein coupled receptor homolog U12 protein

Gene Name

U12

UniProt

P52380

Expression Region

1-347aa

Organism

Human herpesvirus 6A (strain Uganda-1102) (HHV-6 variant A) (Human B lymphotropic virus)

Target Sequence

MDTVIELSKLQFKGNASCTSTPTLKTARIMESAVTGITLTTSIPMIIIVVTTMILYHRVAKHNATSFYVITLFASDFVLMWCVFFMTVNRKQLFSFNRFFCQLVYFIYHAVCSYSISMLAIIATIRYKTLHRRKKTESKTSSTGRNIGILLLASSMCAIPTALFVKTNGMKKTGKCVVYISSKKAYELFLAVKIVFSFIWGVLPTMVFSFFYVIFCKALHDVTEKKYKKTLFFIRILLLSFLLIQIPYIAILICEIAFLYMPQNTCFWLARVEILQLIIRLMPQVHCFSNPLVYAFTGGELRNRFTACFQSFFPKTLCSTQKRKDSDASEHDQNSKSKASVEKNQPL

Tag

N-terminal 10xHis-tagged

Type

CF Transmembrane Protein & Developed Protein

Source

In vitro E.coli expression system

Field of Research

Others

Relevance

Probable G-protein coupled receptor.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

42.6 kDa

References & Citations

"The DNA sequence of human herpesvirus-6: structure, coding content, and genome evolution." Gompels U.A., Nicholas J., Lawrence G.L., Jones M., Thomson B.J., Martin M.E.D., Efstathiou S., Craxton M.A., Macaulay H.A. Virology 209:29-51 (1995)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Suppressor of Cytokine Signaling 7 (SOCS7) Antibody
abx318836-01 20 µg

Suppressor of Cytokine Signaling 7 (SOCS7) Antibody

Sign In for Pricing
View Details
Suppressor of Cytokine Signaling 7 (SOCS7) Antibody
abx318836-02 50 µg

Suppressor of Cytokine Signaling 7 (SOCS7) Antibody

Sign In for Pricing
View Details
Suppressor of Cytokine Signaling 7 (SOCS7) Antibody
abx318836-03 100 µg

Suppressor of Cytokine Signaling 7 (SOCS7) Antibody

Sign In for Pricing
View Details
Suppressor of Cytokine Signaling 7 (SOCS7) Antibody
abx318836-04 200 µg

Suppressor of Cytokine Signaling 7 (SOCS7) Antibody

Sign In for Pricing
View Details
Suppressor of Cytokine Signaling 7 (SOCS7) Antibody
abx318836-05 1 mg

Suppressor of Cytokine Signaling 7 (SOCS7) Antibody

Sign In for Pricing
View Details
Rat Syn1 Pre-designed siRNA Set B
SI214056B 1 Each

Rat Syn1 Pre-designed siRNA Set B

Sign In for Pricing
View Details