Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Stabilin-1 (STAB1), partial

Product Specifications

Product Name Alternative

(Fasciclin, EGF-like, laminin-type EGF-like and link domain-containing scavenger receptor 1) (FEEL-1) (MS-1 antigen)

Abbreviation

Recombinant Human STAB1 protein, partial

Gene Name

STAB1

UniProt

Q9NY15

Expression Region

2319-2462aa

Organism

Homo sapiens (Human)

Target Sequence

STCNGKLLDVLAATANFSTFYGMLLGYANATQRGLDFLDFLDDELTYKTLFVPVNEGFVDNMTLSGPDLELHASNATLLSANASQGKLLPAHSGLSLIISDAGPDNSSWAPVAPGTVVVSRIIVWDIMAFNGIIHALASPLLAP

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Acts as a scavenger receptor for acetylated low density lipoprotein. Binds to both Gram-positive and Gram-negative bacteria and may play a role in defense against bacterial infection. When inhibited in endothelial tube formation assays, there is a marked decrease in cell-cell interactions, suggesting a role in angiogenesis. Involved in the delivery of newly synthesized CHID1/SI-CLP from the biosynthetic compartment to the endosomal/lysosomal system.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

22.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal Antibody to Aryl Hydrocarbon Receptor (AhR)
TRV-0035879-01 20 µL

Monoclonal Antibody to Aryl Hydrocarbon Receptor (AhR)

Sign In for Pricing
View Details
Monoclonal Antibody to Aryl Hydrocarbon Receptor (AhR)
TRV-0035879-02 100 µL

Monoclonal Antibody to Aryl Hydrocarbon Receptor (AhR)

Sign In for Pricing
View Details
Monoclonal Antibody to Aryl Hydrocarbon Receptor (AhR)
TRV-0035879-03 200 µL

Monoclonal Antibody to Aryl Hydrocarbon Receptor (AhR)

Sign In for Pricing
View Details
Monoclonal Antibody to Aryl Hydrocarbon Receptor (AhR)
TRV-0035879-04 1 mL

Monoclonal Antibody to Aryl Hydrocarbon Receptor (AhR)

Sign In for Pricing
View Details
ETHE1 Antibody (Center) Blocking Peptide
MBS9226219-01 0.5 mg

ETHE1 Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details
ETHE1 Antibody (Center) Blocking Peptide
MBS9226219-02 5x 0.5 mg

ETHE1 Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details