Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Muellerian-inhibiting factor/AMH, Mouse

Mullerian inhibitory factor (AMH) plays a crucial role in various reproductive processes. It contributes significantly to Mullerian duct degeneration in male fetal sex differentiation. Muellerian-inhibiting factor/AMH Protein, Mouse is the recombinant mouse-derived Muellerian-inhibiting factor/AMH protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

Muellerian-inhibiting factor/AMH Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/muellerian-inhibiting-factor-amh-protein-mouse.html

Purity

90.0

Smiles

DKGQDGPCALRELSVDLRAERSVLIPETYQANNCQGACRWPQSDRNPRYGNHVVLLLKMQARGAALGRLPCCVPTAYAGKLLISLSEERISADHVPNMVATEC

Molecular Formula

11705 (Gene_ID) P27106 (D450-C552) (Accession)

Molecular Weight

Approximately 14 kDa.The reducing (R) protern migrat es as 14 kDa in SDS-PAGE may be due to molecular structure of protein.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1386), Biotin conjugate, 0.1mg/mL
BNCB1386-500 1x 500 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1386), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human GOLGA7 activation kit by CRISPRa
GA109587 1 Kit

Human GOLGA7 activation kit by CRISPRa

Sign In for Pricing
View Details
Kallikrein 2 (KLK2) Human Gene Knockout Kit (CRISPR)
KN202667BN 1 Kit

Kallikrein 2 (KLK2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
STAT6 Rabbit Polyclonal Antibody
ER40121 100 µL

STAT6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Brain
CR559097 5 µg

Tissue Total RNA, Brain

Sign In for Pricing
View Details
CARD10 Human Gene Knockout Kit (CRISPR)
KN217652RB 1 Kit

CARD10 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details