Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Muellerian-inhibiting factor/AMH, Mouse

Mullerian inhibitory factor (AMH) plays a crucial role in various reproductive processes. It contributes significantly to Mullerian duct degeneration in male fetal sex differentiation. Muellerian-inhibiting factor/AMH Protein, Mouse is the recombinant mouse-derived Muellerian-inhibiting factor/AMH protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

Muellerian-inhibiting factor/AMH Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/muellerian-inhibiting-factor-amh-protein-mouse.html

Purity

90.0

Smiles

DKGQDGPCALRELSVDLRAERSVLIPETYQANNCQGACRWPQSDRNPRYGNHVVLLLKMQARGAALGRLPCCVPTAYAGKLLISLSEERISADHVPNMVATEC

Molecular Formula

11705 (Gene_ID) P27106 (D450-C552) (Accession)

Molecular Weight

Approximately 14 kDa.The reducing (R) protern migrat es as 14 kDa in SDS-PAGE may be due to molecular structure of protein.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Allyl Phenyl Ether-d5
TRC-A572212-1G 1 g

Allyl Phenyl Ether-d5

Sign In for Pricing
View Details
CD244 (NM_001166663) Human Over-expression Lysate
LC432954 20 µg

CD244 (NM_001166663) Human Over-expression Lysate

Sign In for Pricing
View Details
CD45RA (158-4D3), CF640R conjugate, 0.1mg/mL
BNC400028-100 1x 100 µL

CD45RA (158-4D3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Inositol Hexakisphosphate Kinase 2 (IP6K2) (NM_001005909) Human Over-expression Lysate
LY423667 100 µg

Inositol Hexakisphosphate Kinase 2 (IP6K2) (NM_001005909) Human Over-expression Lysate

Sign In for Pricing
View Details
Human ZFP41 activation kit by CRISPRa
GA117276 1 Kit

Human ZFP41 activation kit by CRISPRa

Sign In for Pricing
View Details
Human AGPAT7 (LPCAT4) activation kit by CRISPRa
GA116790 1 Kit

Human AGPAT7 (LPCAT4) activation kit by CRISPRa

Sign In for Pricing
View Details