Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Muellerian-inhibiting factor/AMH, Mouse

Mullerian inhibitory factor (AMH) plays a crucial role in various reproductive processes. It contributes significantly to Mullerian duct degeneration in male fetal sex differentiation. Muellerian-inhibiting factor/AMH Protein, Mouse is the recombinant mouse-derived Muellerian-inhibiting factor/AMH protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

Muellerian-inhibiting factor/AMH Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/muellerian-inhibiting-factor-amh-protein-mouse.html

Purity

90.0

Smiles

DKGQDGPCALRELSVDLRAERSVLIPETYQANNCQGACRWPQSDRNPRYGNHVVLLLKMQARGAALGRLPCCVPTAYAGKLLISLSEERISADHVPNMVATEC

Molecular Formula

11705 (Gene_ID) P27106 (D450-C552) (Accession)

Molecular Weight

Approximately 14 kDa.The reducing (R) protern migrat es as 14 kDa in SDS-PAGE may be due to molecular structure of protein.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Interleukin 2β, IL-2β ELISA KIT
E4104hu-01 48 Well

Human Interleukin 2β, IL-2β ELISA KIT

Sign In for Pricing
View Details
Human Interleukin 2β, IL-2β ELISA KIT
E4104hu-02 96 Well

Human Interleukin 2β, IL-2β ELISA KIT

Sign In for Pricing
View Details
Human Interleukin 2β, IL-2β ELISA KIT
E4104hu-03 5x 96 Tests

Human Interleukin 2β, IL-2β ELISA KIT

Sign In for Pricing
View Details
Human Interleukin 2β, IL-2β ELISA KIT
E4104hu-04 10x 96 Tests

Human Interleukin 2β, IL-2β ELISA KIT

Sign In for Pricing
View Details
Rat Monoclonal Peripheral Node Addressin Antibody (MECA-79R) [DyLight 405]
NBP2-78792V 0.1 mL

Rat Monoclonal Peripheral Node Addressin Antibody (MECA-79R) [DyLight 405]

Sign In for Pricing
View Details
WDR41 3'UTR GFP Stable Cell Line
TU078418 1.0 mL

WDR41 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details