Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Chebulinic acid

Chebulinic acid is a potent inhibitor of M. tuberculosis DNA gyrase. It also can inhibit SMAD-3 phosphorylation and H+ K+-ATPase activity.Chebulinic acid obviously inhibited HQ/Cu (II) - and H (2) O (2) /Cu (II) -mediated pBR322 DNA strand breaks. When MRC-5 cells were treated with HQ/Cu (II), the presence of Chebulinic acid inhibited HQ/Cu (II) -mediated double-strand breaks of genomic DNA [1].Chebulinic acid had no effect on KCl-induced aortic contraction, but irreversibly inhibited the contractile responses to phenylephrine in an apparently non-competitive manner. Chebulinic acid also inhibited contractile responses of rat aorta to 5-hydroxytryptamine and angiotensin II. 3. Chebulinic acid inhibited the binding of [3H]-prazosin to dog aortic microsomal membranes in a concentration-dependent manner with an IC50 value of 0.34 mmol/L.

Product Specifications

CAS Number

18942-26-2

Purity

>98% (HPLC)

Solubility

DMSO:Soluble

Smiles

OC (C[C@H] (C (O[C@@] ([C@H] (O[C@H]1OC (C2=CC (O) =C (O) C (O) =C2) =O) COC (C3=CC (O) =C (O) C (O) =C3) =O) ([H]) [C@@] (OC (C4=CC (O) =C (O) C (O) =C4) =O) ([H]) [C@@]1 ([H]) OC5=O) =O) [C@@] ([C@H]6O) ([H]) C (C5=CC (O) =C7O) =C7OC6=O) =O

Molecular Formula

C41H28O27

Molecular Weight

956.68

Storage Conditions

Storage temperature: -20°C. Stability: ≥ 2 years

Notes

For research use only.

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNX33 Antibody, FITC conjugated
MBS7110409-01 0.05 mg

SNX33 Antibody, FITC conjugated

Sign In for Pricing
View Details
SNX33 Antibody, FITC conjugated
MBS7110409-02 0.1 mg

SNX33 Antibody, FITC conjugated

Sign In for Pricing
View Details
SNX33 Antibody, FITC conjugated
MBS7110409-03 5x 0.1 mg

SNX33 Antibody, FITC conjugated

Sign In for Pricing
View Details
ZNF496 Rabbit Polyclonal Antibody
orb632793-01 50 µg

ZNF496 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZNF496 Rabbit Polyclonal Antibody
orb632793-02 100 µg

ZNF496 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
H-HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-OH
PH00241-01 1 mg

H-HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-OH

Sign In for Pricing
View Details