Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBP4, Human (HEK293, C-His)

RBP4 protein acts as a retinol-binding protein, essential for transporting retinol in blood plasma. It facilitates the delivery of retinol from the liver to peripheral tissues and likely transfers bound all-trans retinol to STRA6 for cell membrane transport. Interactions with TTR prevent kidney glomeruli filtration loss. Direct interaction with STRA6 underscores RBP4's role in intricate retinol transport and distribution processes in the body. RBP4 Protein, Human (HEK293, C-His) is the recombinant human-derived RBP4 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

RBP4 Protein, Human (HEK293, C-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rbp4-protein-human-hek293-c-his.html

Purity

95.0

Smiles

ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL

Molecular Formula

5950 (Gene_ID) P02753 (E19-L201) (Accession)

Molecular Weight

Approximately 21 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM32 (E3 Ubiquitin-protein Ligase TRIM32, 72kD Tat-interacting Protein, Tripartite Motif-containing Protein 32, Zinc Finger Protein HT2A, HT2A) (MaxLight 750) discontinued
134742-ML750 100 µL

TRIM32 (E3 Ubiquitin-protein Ligase TRIM32, 72kD Tat-interacting Protein, Tripartite Motif-containing Protein 32, Zinc Finger Protein HT2A, HT2A) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Phenylephrine Impurity 53
RM-P141253-01 10 mg

Phenylephrine Impurity 53

Sign In for Pricing
View Details
Phenylephrine Impurity 53
RM-P141253-02 25 mg

Phenylephrine Impurity 53

Sign In for Pricing
View Details
Phenylephrine Impurity 53
RM-P141253-03 50 mg

Phenylephrine Impurity 53

Sign In for Pricing
View Details
Phenylephrine Impurity 53
RM-P141253-04 100 mg

Phenylephrine Impurity 53

Sign In for Pricing
View Details
Human Primary Nucleus Pulposus Cells
RPC-170 5x 10^5

Human Primary Nucleus Pulposus Cells

Sign In for Pricing
View Details