Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBP4, Human (HEK293, C-His)

RBP4 protein acts as a retinol-binding protein, essential for transporting retinol in blood plasma. It facilitates the delivery of retinol from the liver to peripheral tissues and likely transfers bound all-trans retinol to STRA6 for cell membrane transport. Interactions with TTR prevent kidney glomeruli filtration loss. Direct interaction with STRA6 underscores RBP4's role in intricate retinol transport and distribution processes in the body. RBP4 Protein, Human (HEK293, C-His) is the recombinant human-derived RBP4 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

RBP4 Protein, Human (HEK293, C-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rbp4-protein-human-hek293-c-his.html

Purity

95.0

Smiles

ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL

Molecular Formula

5950 (Gene_ID) P02753 (E19-L201) (Accession)

Molecular Weight

Approximately 21 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal GSAP Antibody [Alexa Fluor 750]
NBP1-78376AF750 0.1 mL

Rabbit Polyclonal GSAP Antibody [Alexa Fluor 750]

Sign In for Pricing
View Details
Borax Carmine (Grenacher’s), Aqueous Sta
S004-125ML 1 unit

Borax Carmine (Grenacher’s), Aqueous Sta

Sign In for Pricing
View Details
Dennd1a sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6196508 1.0 µg DNA

Dennd1a sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
PPRC1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
37507124 3x 1.0µg DNA

PPRC1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Boc-MLF TFA (67247-12-5 free base)
MF-0004710-01 25 mg

Boc-MLF TFA (67247-12-5 free base)

Sign In for Pricing
View Details
Boc-MLF TFA (67247-12-5 free base)
MF-0004710-02 50 mg

Boc-MLF TFA (67247-12-5 free base)

Sign In for Pricing
View Details