Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBP4, Human (HEK293, C-His)

RBP4 protein acts as a retinol-binding protein, essential for transporting retinol in blood plasma. It facilitates the delivery of retinol from the liver to peripheral tissues and likely transfers bound all-trans retinol to STRA6 for cell membrane transport. Interactions with TTR prevent kidney glomeruli filtration loss. Direct interaction with STRA6 underscores RBP4's role in intricate retinol transport and distribution processes in the body. RBP4 Protein, Human (HEK293, C-His) is the recombinant human-derived RBP4 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

RBP4 Protein, Human (HEK293, C-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rbp4-protein-human-hek293-c-his.html

Purity

95.0

Smiles

ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL

Molecular Formula

5950 (Gene_ID) P02753 (E19-L201) (Accession)

Molecular Weight

Approximately 21 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Aromatase (CYP19A1) ELISA Kit
abx354909 96 Well

Monkey Aromatase (CYP19A1) ELISA Kit

Sign In for Pricing
View Details
Mouse Dhx9 activation kit by CRISPRa
GA201050 1 Kit

Mouse Dhx9 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human CAMKV Protein (His & GST tag)
E53A06726 50 µg

Recombinant Human CAMKV Protein (His & GST tag)

Sign In for Pricing
View Details
Compound NP-008821
MBS5795151 Inquire

Compound NP-008821

Sign In for Pricing
View Details
IFT52 (NM_016004) Human Over-expression Lysate
LS051098-20ug 20 µg

IFT52 (NM_016004) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus Photosystem I reaction center subunit IX 2 (psaJ2), partial
MBS7080412 Inquire

Recombinant Prochlorococcus marinus Photosystem I reaction center subunit IX 2 (psaJ2), partial

Sign In for Pricing
View Details