Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBP4, Human (HEK293, C-His)

RBP4 protein acts as a retinol-binding protein, essential for transporting retinol in blood plasma. It facilitates the delivery of retinol from the liver to peripheral tissues and likely transfers bound all-trans retinol to STRA6 for cell membrane transport. Interactions with TTR prevent kidney glomeruli filtration loss. Direct interaction with STRA6 underscores RBP4's role in intricate retinol transport and distribution processes in the body. RBP4 Protein, Human (HEK293, C-His) is the recombinant human-derived RBP4 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

RBP4 Protein, Human (HEK293, C-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rbp4-protein-human-hek293-c-his.html

Purity

95.0

Smiles

ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL

Molecular Formula

5950 (Gene_ID) P02753 (E19-L201) (Accession)

Molecular Weight

Approximately 21 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Orai1 Mouse Gene Knockout Kit (CRISPR)
KN512620 1 Kit

Orai1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Il2 3'UTR GFP Stable Cell Line
TU256230 1.0 mL

Il2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Mouse Ankib1 (NM_001289528) AAV Particle
MR231195A1V 250 µL

Mouse Ankib1 (NM_001289528) AAV Particle

Sign In for Pricing
View Details
AZI2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV652342 1.0 µg DNA

AZI2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
WDTC1 CRISPR/Cas9 KO Plasmid (h)
sc-411657 20 µg

WDTC1 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Cattle IL5 (Interleukin 5) ELISA Kit
EK245369 96 Well

Cattle IL5 (Interleukin 5) ELISA Kit

Sign In for Pricing
View Details