Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBP4, Human (HEK293, C-His)

RBP4 protein acts as a retinol-binding protein, essential for transporting retinol in blood plasma. It facilitates the delivery of retinol from the liver to peripheral tissues and likely transfers bound all-trans retinol to STRA6 for cell membrane transport. Interactions with TTR prevent kidney glomeruli filtration loss. Direct interaction with STRA6 underscores RBP4's role in intricate retinol transport and distribution processes in the body. RBP4 Protein, Human (HEK293, C-His) is the recombinant human-derived RBP4 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

RBP4 Protein, Human (HEK293, C-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rbp4-protein-human-hek293-c-his.html

Purity

95.0

Smiles

ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL

Molecular Formula

5950 (Gene_ID) P02753 (E19-L201) (Accession)

Molecular Weight

Approximately 21 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBP2 Rabbit Polyclonal Antibody
E28PT1685 100 µL

FBP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human CADM2 Knockout HEK293T cell line
GTR15402521 1 Vial

Human CADM2 Knockout HEK293T cell line

Sign In for Pricing
View Details
TEK (TEK Tyrosine Kinase, Endothelial, CD202B, TIE-2, TIE2, VMCM, VMCM1) (Biotin)
252534-Biotin 100 µL

TEK (TEK Tyrosine Kinase, Endothelial, CD202B, TIE-2, TIE2, VMCM, VMCM1) (Biotin)

Sign In for Pricing
View Details
SSPE Buffer 0.1X with 0.2% SDS
22050017-1 1 L

SSPE Buffer 0.1X with 0.2% SDS

Sign In for Pricing
View Details
Mouse Monoclonal Siglec-1/CD169 Antibody (ED3) [Alexa Fluor 700]
NB100-65301AF700 0.1 mL

Mouse Monoclonal Siglec-1/CD169 Antibody (ED3) [Alexa Fluor 700]

Sign In for Pricing
View Details
Human TBC1 domain family member 3F, TBC1D3F ELISA KIT
ELI-53141h 96 Tests

Human TBC1 domain family member 3F, TBC1D3F ELISA KIT

Sign In for Pricing
View Details