Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBP4, Human (HEK293, C-His)

RBP4 protein acts as a retinol-binding protein, essential for transporting retinol in blood plasma. It facilitates the delivery of retinol from the liver to peripheral tissues and likely transfers bound all-trans retinol to STRA6 for cell membrane transport. Interactions with TTR prevent kidney glomeruli filtration loss. Direct interaction with STRA6 underscores RBP4's role in intricate retinol transport and distribution processes in the body. RBP4 Protein, Human (HEK293, C-His) is the recombinant human-derived RBP4 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

RBP4 Protein, Human (HEK293, C-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rbp4-protein-human-hek293-c-his.html

Purity

95.0

Smiles

ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL

Molecular Formula

5950 (Gene_ID) P02753 (E19-L201) (Accession)

Molecular Weight

Approximately 21 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD49f (Laminin Receptor, Integrin alpha6, VLA alpha6, Platelet gpIc) (AP) discontinued
C2405-04B-AP 100 µL

CD49f (Laminin Receptor, Integrin alpha6, VLA alpha6, Platelet gpIc) (AP) discontinued

Sign In for Pricing
View Details
Olfr568 Recombinant Protein (Mouse)
RP158195 100 µg

Olfr568 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
AIBZIP (Androgen Induced Basic Leucine Zipper, ATCE1, cAMP Responsive Element Binding Protein 3 Like 4, Cyclic AMP-responsive Element-binding Protein 3-like Protein 4, Attaching to CRE-like 1, Cyclic AMP-responsive Element-binding Protein 4, cAMP-responsive Element-binding Protein 4, Transcript Induced in Spermiogenesis Protein 40, hJAL, CREB3, CREB3L4, CREB4, JAL, TISP40) (HRP)
A0857-25A-HRP 100 µL

AIBZIP (Androgen Induced Basic Leucine Zipper, ATCE1, cAMP Responsive Element Binding Protein 3 Like 4, Cyclic AMP-responsive Element-binding Protein 3-like Protein 4, Attaching to CRE-like 1, Cyclic AMP-responsive Element-binding Protein 4, cAMP-responsive Element-binding Protein 4, Transcript Induced in Spermiogenesis Protein 40, hJAL, CREB3, CREB3L4, CREB4, JAL, TISP40) (HRP)

Sign In for Pricing
View Details
Ferric Nitrate Nonahydrate 98% AR
01215 00500 500 g

Ferric Nitrate Nonahydrate 98% AR

Sign In for Pricing
View Details
Rabbit Polyclonal Lambda5/IGLL1 Antibody [Alexa Fluor 488]
NBP2-98929AF488 0.1 mL

Rabbit Polyclonal Lambda5/IGLL1 Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
LOC374491 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV706063 1.0 µg DNA

LOC374491 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details