Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GAMT, Human (His)

GAMT protein uses S-adenosylmethionine as a methyl donor to catalyze the conversion of guanidinoacetic acid into creatine, playing a key role in cell metabolism. This enzyme activity is essential for the biosynthesis of creatine, a compound necessary for cellular energy storage and transport. GAMT Protein, Human (His) is the recombinant human-derived GAMT protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.

Product Specifications

Product Name Alternative

GAMT Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gamt-protein-human-his.html

Purity

95.0

Smiles

MSAPSATPIFAPGENCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYMHALAAAASSKGGRVLEVGFGMAIAASKVQEAPIDEHWIIECNDGVFQRLRDWAPRQTHKVIPLKGLWEDVAPTLPDGHFDGILYDTYPLSEETWHTHQFNFIKNHAFRLLKPGGVLTYCNLTSWGELMKSKYSDITIMFEETQVPALLEAGFRRENIRTEVMALVPPADCRYYAFPQMITPLVTKG

Molecular Formula

2593 (Gene_ID) Q14353-1 (M1-G236) (Accession)

Molecular Weight

27-32 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SYTL2 Human Over-expression Lysate
orb1355526 100 µg

SYTL2 Human Over-expression Lysate

Sign In for Pricing
View Details
Gdf3 ORF Vector (Mouse) (pORF)
21418014 1.0 µg DNA

Gdf3 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Eif2c3-set siRNA/shRNA/RNAi Lentivector (Mouse)
19091094 4x 500 ng

Eif2c3-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
C21orf58 AAV Vector (Human) (CMV)
14344101 1 µg

C21orf58 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
UPF3A Protein Vector (Mouse) (pPM-C-HA)
PV244264 500 ng

UPF3A Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Inhibin beta B chain (FITC)
320482-01 50 µg

Inhibin beta B chain (FITC)

Sign In for Pricing
View Details