Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TROP-2, Rat (246a.a, HEK293, His)

The TROP-2 protein serves as a growth factor receptor and plays a key role in mediating cellular responses related to growth regulation. This implies its importance in transducing signals that influence cell growth processes. TROP-2 Protein, Rat (246a.a, HEK293, His) is the recombinant rat-derived TROP-2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TROP-2 Protein, Rat (246a.a, HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trop-2-protein-rat-246a-a-hek293-his.html

Purity

95.00

Smiles

QINCTCPTNKMTICNSNGPGGVCQCRAIGSQVLVDCSTLTSKCLLLKARMSARKSSRRLVNPSEHAILDNDGLYDPECDDKGRFKARQCNQTSVCWCVNSVGVRRTDKGDQSLRCDEVVRTHHILIELRHRPTDRAFNHSDLDSELRRLFKERYKLHPSFLAAVHYEEPTIQIELQQNASQKGLRDVDIADAAYYFERDIKGESLFVGRRGLDVQVRGEPLHVERTLIYYLDEKPPQFSMKRLTTG

Molecular Formula

494343 (Gene_ID) Q6P9Z6 (Q25-G270) (Accession)

Molecular Weight

Approximately 35-50 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C11orf59 sgRNA CRISPR Lentivector set (Human)
K0285501 3x 1.0 µg

C11orf59 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Rat Fetuin B (FETUB) ELISA Kit
DLR-FETUB-Ra-96T 96 Tests

Rat Fetuin B (FETUB) ELISA Kit

Sign In for Pricing
View Details
PLA2G2A Rabbit mAb
RDSA67969 100 µL

PLA2G2A Rabbit mAb

Sign In for Pricing
View Details
Human Proteasome 26S Subunit, Non ATPase 10 (PSMD10) ELISA Kit
RDR-PSMD10-Hu-48Tests 48 Tests

Human Proteasome 26S Subunit, Non ATPase 10 (PSMD10) ELISA Kit

Sign In for Pricing
View Details
Olfr1469 (NM_146695) Mouse Tagged Lenti ORF Clone
MR213714L4 10 µg

Olfr1469 (NM_146695) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human Large Multifunctional Peptidase 2 (LMP2) ELISA Kit
MBS4500795-01 48 Tests

Human Large Multifunctional Peptidase 2 (LMP2) ELISA Kit

Sign In for Pricing
View Details