Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMAD3, Human/Mouse/Rat (sf9, His-GST, solution)

The SMAD3 protein is an R-SMAD that acts as an intracellular signal transducer activated by TGF-β and activin type 1 receptor kinase.It binds TRE elements and regulates TGF-β target genes.SMAD3 Protein, Human/Mouse/Rat (sf9, His-GST) is the recombinant rat-derived SMAD3 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

Product Specifications

Product Name Alternative

SMAD3 Protein, Human/Mouse/Rat (sf9, His-GST, solution), Rat; Mouse; Human, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/smad3-protein-human-mouse-rat-sf9-his-gst.html

Purity

93.00

Smiles

MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS

Molecular Formula

4088/17127/25631 (Gene_ID) P84022-1/Q8BUN5/P84025 (M1-S425) (Accession)

Molecular Weight

Approximately 70-80 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Golgin 84 (D-5) Alexa Fluor® 546
sc-365337 AF546 200 µg/mL

Golgin 84 (D-5) Alexa Fluor® 546

Sign In for Pricing
View Details
Porcine Heat Shock Protein 90kDa Alpha A1 (HSP90aA1) ELISA Kit
RDR-HSP90aA1-p-01 96 Tests

Porcine Heat Shock Protein 90kDa Alpha A1 (HSP90aA1) ELISA Kit

Sign In for Pricing
View Details
Porcine Heat Shock Protein 90kDa Alpha A1 (HSP90aA1) ELISA Kit
RDR-HSP90aA1-p-02 48 Tests

Porcine Heat Shock Protein 90kDa Alpha A1 (HSP90aA1) ELISA Kit

Sign In for Pricing
View Details
PSAP (NM_002778) Human 3' UTR Clone
SC212845 10 µg

PSAP (NM_002778) Human 3' UTR Clone

Sign In for Pricing
View Details
TRAF3IP2 Antibody
A37386-100UL 100 µL

TRAF3IP2 Antibody

Sign In for Pricing
View Details
B4galnt1 (NM_022860) Rat Tagged Lenti ORF Clone
RR200805L4 10 µg

B4galnt1 (NM_022860) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details