Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-2, Mouse (154a.a)

FGF-2 protein is a member of the fibroblast growth factor family, involved in biological processes such as bone healing, cartilage repair, tumor development, and nerve regeneration. FGF-2 is also a mitogen that accelerates cell proliferation. It regulates immune processes by specifically targeting tyrosine kinase receptors and activating the FGF/FGFR signaling pathway. FGF-2 protein, Mouse (154 a.a.), is a recombinant protein produced in E. coli (Escherichia coli), consisting of 154 amino acids (M1-S154), and is untagged[1][2][3][4][5][6][7][8][9].

Product Specifications

Product Name Alternative

FGF-2 Protein, Mouse (154a.a), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-2-protein-mouse-154a-a.html

Purity

98.00

Smiles

MAASGITSLPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Molecular Formula

14173 (Gene_ID) P15655 (M1-S154) (Accession)

Molecular Weight

Approximately 16-17 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Zhang J, et al. FGF2: a key regulator augmenting tendon-to-bone healing and cartilage repair. Regen Med. 2020 Sep;15 (9) :2129-2142.|[2]Jimenez-Pascual A, et al. FGF2: a novel druggable target for glioblastoma? Expert Opin Ther Targets. 2020 Apr;24 (4) :311-318.|[3]Raballo R, et al. Basic fibroblast growth factor (Fgf2) is necessary for cell proliferation and neurogenesis in the developing cerebral cortex[J]. Journal of Neuroscience, 2000, 20 (13) : 5012-5023.|[4]Presta M, et al. Inflammatory cells and chemokines sustain FGF2-induced angiogenesis. Eur Cytokine Netw. 2009 Jun;20 (2) :39-50.|[5]Perez JA, et al. A new role for FGF2 as an endogenous inhibitor of anxiety. J Neurosci. 2009 May 13;29 (19) :6379-87.|[6]Akl MR, et al. Molecular and clinical significance of fibroblast growth factor 2 (FGF2 /bFGF) in malignancies of solid and hematological cancers for personalized therapies. Oncotarget. 2016 Jul 12;7 (28) :44735-44762.|[7]Izikki M, et al. Endothelial-derived FGF2 contributes to the progression of pulmonary hypertension in humans and rodents. J Clin Invest. 2009 Mar;119 (3) :512-23.|[8]Israsena N, et al. The presence of FGF2 signaling determines whether beta-catenin exerts effects on proliferation or neuronal differentiation of neural stem cells. Dev Biol. 2004 Apr 1;268 (1) :220-31. |[9]Sato K, et al. Efficacy of intracoronary versus intravenous FGF-2 in a pig model of chronic myocardial ischemia. Ann Thorac Surg. 2000 Dec;70 (6) :2113-8.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RALY Antibody
KC-2726-01 50 μL

RALY Antibody

Sign In for Pricing
View Details
RALY Antibody
KC-2726-02 100 µL

RALY Antibody

Sign In for Pricing
View Details
RALY Antibody
KC-2726-03 1 mL

RALY Antibody

Sign In for Pricing
View Details
DNAzure® Blue Nucleic Acid Gel Stain, 100X
#41020 1x 10 mL

DNAzure® Blue Nucleic Acid Gel Stain, 100X

Sign In for Pricing
View Details
Chk1 (CHEK1) Rabbit Polyclonal Antibody
TA374724 100 µL

Chk1 (CHEK1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EnzyChrom™ Invertase Assay Kit
EIVT-100 100 Tests

EnzyChrom™ Invertase Assay Kit

Sign In for Pricing
View Details