Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-2, Mouse (154a.a)

FGF-2 protein is a member of the fibroblast growth factor family, involved in biological processes such as bone healing, cartilage repair, tumor development, and nerve regeneration. FGF-2 is also a mitogen that accelerates cell proliferation. It regulates immune processes by specifically targeting tyrosine kinase receptors and activating the FGF/FGFR signaling pathway. FGF-2 protein, Mouse (154 a.a.), is a recombinant protein produced in E. coli (Escherichia coli), consisting of 154 amino acids (M1-S154), and is untagged[1][2][3][4][5][6][7][8][9].

Product Specifications

Product Name Alternative

FGF-2 Protein, Mouse (154a.a), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-2-protein-mouse-154a-a.html

Purity

98.00

Smiles

MAASGITSLPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Molecular Formula

14173 (Gene_ID) P15655 (M1-S154) (Accession)

Molecular Weight

Approximately 16-17 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Zhang J, et al. FGF2: a key regulator augmenting tendon-to-bone healing and cartilage repair. Regen Med. 2020 Sep;15 (9) :2129-2142.|[2]Jimenez-Pascual A, et al. FGF2: a novel druggable target for glioblastoma? Expert Opin Ther Targets. 2020 Apr;24 (4) :311-318.|[3]Raballo R, et al. Basic fibroblast growth factor (Fgf2) is necessary for cell proliferation and neurogenesis in the developing cerebral cortex[J]. Journal of Neuroscience, 2000, 20 (13) : 5012-5023.|[4]Presta M, et al. Inflammatory cells and chemokines sustain FGF2-induced angiogenesis. Eur Cytokine Netw. 2009 Jun;20 (2) :39-50.|[5]Perez JA, et al. A new role for FGF2 as an endogenous inhibitor of anxiety. J Neurosci. 2009 May 13;29 (19) :6379-87.|[6]Akl MR, et al. Molecular and clinical significance of fibroblast growth factor 2 (FGF2 /bFGF) in malignancies of solid and hematological cancers for personalized therapies. Oncotarget. 2016 Jul 12;7 (28) :44735-44762.|[7]Izikki M, et al. Endothelial-derived FGF2 contributes to the progression of pulmonary hypertension in humans and rodents. J Clin Invest. 2009 Mar;119 (3) :512-23.|[8]Israsena N, et al. The presence of FGF2 signaling determines whether beta-catenin exerts effects on proliferation or neuronal differentiation of neural stem cells. Dev Biol. 2004 Apr 1;268 (1) :220-31. |[9]Sato K, et al. Efficacy of intracoronary versus intravenous FGF-2 in a pig model of chronic myocardial ischemia. Ann Thorac Surg. 2000 Dec;70 (6) :2113-8.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD98 Antibody
KC-2740-01 50 μL

CD98 Antibody

Sign In for Pricing
View Details
CD98 Antibody
KC-2740-02 100 µL

CD98 Antibody

Sign In for Pricing
View Details
CD98 Antibody
KC-2740-03 1 mL

CD98 Antibody

Sign In for Pricing
View Details
3-Propanoylbenzonitrile
TRC-B524768-50MG 50 mg

3-Propanoylbenzonitrile

Sign In for Pricing
View Details
SERPINB8 Mouse Monoclonal Antibody [Clone ID: OTI8F10]
CF810530 100 µg

SERPINB8 Mouse Monoclonal Antibody [Clone ID: OTI8F10]

Sign In for Pricing
View Details
OR10Z1 (NM_001004478) Human Over-expression Lysate
LY423781 100 µg

OR10Z1 (NM_001004478) Human Over-expression Lysate

Sign In for Pricing
View Details