Recombinant Rat Non-lysosomal glucosylceramidase (Gba2), partial

(NLGase) (Beta-glucocerebrosidase 2) (Beta-glucosidase 2) (Bile acid beta-glucosidase GBA2) (Bile acid glucosyl transferase GBA2) (Cholesterol glucosyltransferase GBA2) (Cholesteryl-beta-glucosidase GBA2) (Glucosylceramidase 2) (Non-lysosomal cholesterol glycosyltransferase) (Non-lysosomal galactosylceramidase) (Non-lysosomal glycosylceramidase)

GRFGYLEGQEYRMYNTYDVHFYASFALVMLWPKLELSLQYDMALATFKEDLTRRRYLMSGVVAPVKRRNVIPHDIGDPDDEPWLRVNAYLIHDTADWKDLNLKFVLQVYRDYYLTGDQGFLKDMWPVCLAVMESEMKFDKDQDGLIENGGYADQTYDGWVTTGPSAYCGGLWLAAVAVMVQMAVLCGAQDVQDKFSSILCRGREAYERLLWNGRYYNYDSSSQPQSRSVMSDQCAGQWFLRACGLGEGDTEVFPTLHVVRALKTIFELNVQAFAGGAMGAVNGMQPHGVPDRSSVQSDEVWVGVVYGLAATMIQEGLTWEGFRTAEGCYRTVWERLGLAFQTPEAYCQQRVFRSLAYMRPLSIWAM

Non-lysosomal glucosylceramidase that catalyzes the hydrolysis of glucosylceramides/GlcCers (such as beta-D-glucosyl- (1<->1') -N-acylsphing-4-enine) to free glucose and ceramides (such as N-acylsphing-4-enine) . GlcCers are membrane glycosphingolipids that have a wide intracellular distribution. They are the main precursors of more complex glycosphingolipids that play a role in cellular growth, differentiation, adhesion, signaling, cytoskeletal dynamics and membrane properties. Involved in the transglucosylation of cholesterol, transfers glucose from GlcCer to cholesterol, thereby modifying its water solubility and biological properties. Under specific conditions, may catalyze the reverse reaction, transferring glucose from cholesteryl-3-beta-D-glucoside to ceramide (such as N-acylsphing-4-enine) . May play a role in the metabolism of bile acids. Able to hydrolyze bile acid 3-O-glucosides as well as to produce bile acid-glucose conjugates thanks to a bile acid glucosyl transferase activity. Catalyzes the hydrolysis of galactosylceramides/GalCers (such as beta-D-galactosyl- (1<->1') -N-acylsphing-4-enine), as well as the galactosyl transfer between GalCers and cholesterol in vitro with lower activity compared with their activity against GlcCers.

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

"Genome sequence of the Brown Norway rat yields insights into mammalian evolution." Gibbs R.A., Weinstock G.M., Metzker M.L., Muzny D.M., Sodergren E.J., Scherer S., Scott G., Steffen D., Worley K.C., Burch P.E., Okwuonu G., Hines S., Lewis L., Deramo C., Delgado O., Dugan-Rocha S., Miner G., Morgan M. Collins F.S. Nature 428:493-521 (2004)

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.