Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Glycine max Leghemoglobin C2

Product Specifications

Abbreviation

Recombinant Glycine max Leghemoglobin C2 protein

UniProt

P02236

Expression Region

2-145aa

Organism

Glycine max (Soybean) (Glycine hispida)

Target Sequence

GAFTEKQEALVSSSFEAFKANIPQYSVVFYTSILEKAPAAKDLFSFLSNGVDPSNPKLTGHAEKLFGLVRDSAGQLKANGTVVADAALGSIHAQKAITDPQFVVVKEALLKTIKEAVGDKWSDELSSAWEVAYDELAAAIKKAF

Tag

N-terminal 6xHis-tagged and C-terminal HA-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Provides oxygen to the bacteroids. This role is essential for symbiotic nitrogen fixation.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

20.6 kDa

References & Citations

"Molecular cloning and organization of two leghemoglobin sequences of soybean." Sullivan D., Brisson N., Goodchild B., Verma D.P.S. Nature 289:516-518 (1981)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DCLK1 sgRNA CRISPR Lentivector (Human) (Target 1)
K0565602 1.0 µg DNA

DCLK1 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Peli1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6574705 3x 1.0 µg

Peli1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
4933424B01Rik sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4839908 1.0 µg DNA

4933424B01Rik sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Rabbit Polyclonal ACE1 (891-940) Antibody (Human, Mouse, Rat)
B2020059 100 µL

Rabbit Polyclonal ACE1 (891-940) Antibody (Human, Mouse, Rat)

Sign In for Pricing
View Details
RAC2 Protein Vector (Rat) (pPM-C-HA)
PV297936 500 ng

RAC2 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
DTWD1, ID (DTWD1, DTW domain-containing protein 1) (FITC)
MBS6293656-01 0.2 mL

DTWD1, ID (DTWD1, DTW domain-containing protein 1) (FITC)

Sign In for Pricing
View Details