Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Protein PB1-F2 (PB1)

Product Specifications

Abbreviation

Recombinant Influenza A virus PB1 protein

Gene Name

PB1

UniProt

P0C5V3

Expression Region

1-90aa

Organism

Influenza A virus (strain A/Silky Chicken/Hong Kong/YU100/2002 H5N1 genotype X3)

Target Sequence

MEQEQDTPWTRSIEHINTQRRGNGQQTQKLEHPNSIQLMDHYPRITSRADMHKQIVCWKQWLSLKNPTQGSLKTHVLKRWKLFSKQEWTN

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Plays an important role in promoting lung pathology in both primary viral infection and secondary bacterial infection. Promotes alteration of mitochondrial morphology, dissipation of mitochondrial membrane potential, and cell death. Alternatively, inhibits the production of interferon in the infected cell at the level of host mitochondrial antiviral signaling MAVS. Its level of expression differs greatly depending on which cell type is infected, in a manner that is independent of the levels of expression of other viral proteins. Monocytic cells are more affected than epithelial cells. Seems to disable virus-infected monocytes or other host innate immune cells. During early stage of infection, predisposes the mitochondria to permeability transition through interaction with host SLC25A6/ANT3 and VDAC1. These proteins participate in the formation of the permeability transition pore complex (PTPC) responsible of the release of mitochondrial products that triggers apoptosis.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.3 kDa

References & Citations

"Genesis of a highly pathogenic and potentially pandemic H5N1 influenza virus in eastern Asia." Li K.S., Guan Y., Wang J., Smith G.J.D., Xu K.M., Duan L., Rahardjo A.P., Puthavathana P., Buranathai C., Nguyen T.D., Estoepangestie A.T.S., Chaisingh A., Auewarakul P., Long H.T., Hanh N.T.H., Webby R.J., Poon L.L.M., Chen H. Peiris J.S.M. Nature 430:209-213 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Albumin, Human Serum (HSA) (MaxLight 550)
214477-ML550 100 µL

Albumin, Human Serum (HSA) (MaxLight 550)

Ask
View Details
8-Demethoxy-8-fluoro gatifloxacin
271394-01 5 mg

8-Demethoxy-8-fluoro gatifloxacin

Ask
View Details
8-Demethoxy-8-fluoro gatifloxacin
271394-02 10 mg

8-Demethoxy-8-fluoro gatifloxacin

Ask
View Details
8-Demethoxy-8-fluoro gatifloxacin
271394-03 25 mg

8-Demethoxy-8-fluoro gatifloxacin

Ask
View Details
8-Demethoxy-8-fluoro gatifloxacin
271394-04 50 mg

8-Demethoxy-8-fluoro gatifloxacin

Ask
View Details
8-Demethoxy-8-fluoro gatifloxacin
271394-05 100 mg

8-Demethoxy-8-fluoro gatifloxacin

Ask
View Details