CD157, Human (HEK293, His)
CD157 Protein, Human (HEK293, His) is a recombinant human CD157 expressed in HEK 293 cells with a His tag at the N-terminus. CD157 Protein is a cell surface receptor and an immunoregulatory molecule[1][2].
Product Specifications
Product Name Alternative
CD157 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd157-protein-human-hek293-his.html
Purity
98.0
Smiles
GARARWRGEGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALKSAAAATQRKHHHHHH
Molecular Formula
683 (Gene_ID) Q10588 (G29-K292) (Accession)
Molecular Weight
Approximately 37 kDa
References & Citations
[1]Hussain AM, et, al. Functional expression of secreted mouse BST-1 in yeast. Protein Expr Purif. 1998 Feb;12 (1) :133-7.|[2]Ortolan E, et, al. CD157, the Janus of CD38 but with a unique personality. Cell Biochem Funct. 2002 Dec;20 (4) :309-22.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC051037-100 1x 100 µL
CD44 Standard (DF1485), CF405M conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740204-100 1x 100 µL
Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
