Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD157, Human (HEK293, His)

CD157 Protein, Human (HEK293, His) is a recombinant human CD157 expressed in HEK 293 cells with a His tag at the N-terminus. CD157 Protein is a cell surface receptor and an immunoregulatory molecule[1][2].

Product Specifications

Product Name Alternative

CD157 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd157-protein-human-hek293-his.html

Purity

98.0

Smiles

GARARWRGEGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALKSAAAATQRKHHHHHH

Molecular Formula

683 (Gene_ID) Q10588 (G29-K292) (Accession)

Molecular Weight

Approximately 37 kDa

References & Citations

[1]Hussain AM, et, al. Functional expression of secreted mouse BST-1 in yeast. Protein Expr Purif. 1998 Feb;12 (1) :133-7.|[2]Ortolan E, et, al. CD157, the Janus of CD38 but with a unique personality. Cell Biochem Funct. 2002 Dec;20 (4) :309-22.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC16A6 Protein Lysate
OCOA12999-20UG 20 µg

SLC16A6 Protein Lysate

Sign In for Pricing
View Details
MFluor™ Green 620 Anti-non-human primates/ human CD170 Antibody *1A5*
117000U1-AAT 500 Tests

MFluor™ Green 620 Anti-non-human primates/ human CD170 Antibody *1A5*

Sign In for Pricing
View Details
Rabbit Anti-Rat Galectin 1 (GAL1) Polyclonal Antibody
VD1N444 1 Each

Rabbit Anti-Rat Galectin 1 (GAL1) Polyclonal Antibody

Sign In for Pricing
View Details
ROX Reference Dye (High)
ROXH-50μL 50 μL

ROX Reference Dye (High)

Sign In for Pricing
View Details
ANO2 CRISPR Activation Plasmid (m)
sc-433990-ACT 20 µg

ANO2 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
CTNNBL1 (NM_030877) Human Over-expression Lysate
LY403090 100 µg

CTNNBL1 (NM_030877) Human Over-expression Lysate

Sign In for Pricing
View Details