Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-25 (IL25)

Recombinant Human Interleukin-25 (IL25)

Product Specifications

Product Name Alternative

Interleukin-17E

UniProt

Q9H293

Expression Region

33-177aa

Tag

N-terminal hFc1-tagged and C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation; Cell Biology

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Syndecan-1/CD138 Alexa Fluor 350 Antibody
FAB2966U-100UG 100 µg

Mouse Syndecan-1/CD138 Alexa Fluor 350 Antibody

Sign In for Pricing
View Details
SAP30 (Sin3A-Associated Protein, 30kD) (MaxLight 490)
251425-ML490 100 µL

SAP30 (Sin3A-Associated Protein, 30kD) (MaxLight 490)

Sign In for Pricing
View Details
Pcdhb16-set siRNA/shRNA/RNAi Lentivector (Mouse)
36146094 4x 500 ng

Pcdhb16-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Mouse Monoclonal UCH-L1/PGP9.5 Antibody (UCHL1/775)
NBP2-44795-0.02mg 0.02 mg

Mouse Monoclonal UCH-L1/PGP9.5 Antibody (UCHL1/775)

Sign In for Pricing
View Details
FANCE Antibody Blocking Peptide
orb1513518 500 µg

FANCE Antibody Blocking Peptide

Sign In for Pricing
View Details
Olfr971 Protein Vector (Mouse) (pPM-C-HA)
PV212256 500 ng

Olfr971 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details