Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-25 (IL25)

Recombinant Human Interleukin-25 (IL25)

Product Specifications

Product Name Alternative

Interleukin-17E

UniProt

Q9H293

Expression Region

33-177aa

Tag

N-terminal hFc1-tagged and C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation; Cell Biology

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RP6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
40705111 3x 1.0 µg

RP6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Lentiviral human OR4C46 shRNA (UAS) - Lentiviral human OR4C46 shRNA (UAS) (25)
GTR15295424 1 Vial

Lentiviral human OR4C46 shRNA (UAS) - Lentiviral human OR4C46 shRNA (UAS) (25)

Sign In for Pricing
View Details
Canine Myosin-4 (MYH4) ELISA Kit
MBS7230300-01 48 Well

Canine Myosin-4 (MYH4) ELISA Kit

Sign In for Pricing
View Details
Canine Myosin-4 (MYH4) ELISA Kit
MBS7230300-02 96 Well

Canine Myosin-4 (MYH4) ELISA Kit

Sign In for Pricing
View Details
Canine Myosin-4 (MYH4) ELISA Kit
MBS7230300-03 5x 96 Well

Canine Myosin-4 (MYH4) ELISA Kit

Sign In for Pricing
View Details
Canine Myosin-4 (MYH4) ELISA Kit
MBS7230300-04 10x 96 Well

Canine Myosin-4 (MYH4) ELISA Kit

Sign In for Pricing
View Details