Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Keratocan (KERA)

Recombinant Human Keratocan (KERA)

Product Specifications

Product Name Alternative

Keratan sulfate proteoglycan keratocan

UniProt

O60938

Expression Region

21-352aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RSVRQVYEVHDSDDWTIHDFECPMECFCPPSFPTALYCENRGLKEIPAIPSRIWYLYLQNNLIETIPEKPFENATQLRWINLNKNKITNYGIEKGALSQLKKLLFLFLEDNELEEVPSPLPRSLEQLQLARNKVSRIPQGTFSNLENLTLLDLQNNKLVDNAFQRDTFKGLKNLMQLNMAKNALRNMPPRLPANTMQLFLDNNSIEGIPENYFNVIPKVAFLRLNHNKLSDEGLPSRGFDVSSILDLQLSHNQLTKVPRISAHLQHLHLDHNKIKSVNVSVICPSPSMLPAERDSFSYGPHLRYLRLDGNEIKPPIPMALMTCFRLLQAVII

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thrombospondin 5 Lentiviral Activation Particles (h)
sc-402797-LAC 200 µL

Thrombospondin 5 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Corticosterone 21-acetate
268687-01 25 mg

Corticosterone 21-acetate

Sign In for Pricing
View Details
Corticosterone 21-acetate
268687-02 50 mg

Corticosterone 21-acetate

Sign In for Pricing
View Details
Corticosterone 21-acetate
268687-03 100 mg

Corticosterone 21-acetate

Sign In for Pricing
View Details
Corticosterone 21-acetate
268687-04 250 mg

Corticosterone 21-acetate

Sign In for Pricing
View Details
Corticosterone 21-acetate
268687-05 500 mg

Corticosterone 21-acetate

Sign In for Pricing
View Details