Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Histone H2A.J (H2AJ)

Recombinant Human Histone H2A.J (H2AJ)

Product Specifications

Product Name Alternative

H2a/j; H2AJ ; H2AFJ

UniProt

Q9BTM1

Expression Region

2-129aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SGRGKQGGKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESQKTKSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Kidney
CS714884 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
Ypel5 (NM_027166) Mouse Tagged ORF Clone
MG200584 10 µg

Ypel5 (NM_027166) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
PPAP2A (PLPP1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H4]
TA506857BM 100 µL

PPAP2A (PLPP1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H4]

Sign In for Pricing
View Details
LETM2 Human Gene Knockout Kit (CRISPR)
KN415607 1 Kit

LETM2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human LY6H Protein (His Tag)
PKSH032715-01 10 µg

Recombinant Human LY6H Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human LY6H Protein (His Tag)
PKSH032715-02 50 µg

Recombinant Human LY6H Protein (His Tag)

Sign In for Pricing
View Details