Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacter aerogenes Outer membrane protein A (ompA), partial

Recombinant Enterobacter aerogenes Outer membrane protein A (ompA), partial

Product Specifications

Product Name Alternative

Outer membrane porin A

UniProt

P09146

Expression Region

195-350aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Yeast

Origin

Klebsiella aerogenes (Enterobacter aerogenes)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FGQEDNAPVVAPAPAPAPEVTTKTFTLKSDVLFNFNKATLKPEGQQALDQLYTQLSNMDPKDGSAVVLGYTDRIGSEQYNQKLSEKRAQSVVDYLVAKGIPANKISARGMGESDPVTGNTCDNVKARAALIDCLAPDRRVAIEVKGYKDVVTQPQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EEF2KMT Polyclonal Antibody, Biotin Conjugated
A58895-050 50 µL

EEF2KMT Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Podoplanin Protein, Human, Recombinant (His)
TMPY-05801-01 5 µg

Podoplanin Protein, Human, Recombinant (His)

Sign In for Pricing
View Details
Podoplanin Protein, Human, Recombinant (His)
TMPY-05801-02 10 µg

Podoplanin Protein, Human, Recombinant (His)

Sign In for Pricing
View Details
Podoplanin Protein, Human, Recombinant (His)
TMPY-05801-03 20 µg

Podoplanin Protein, Human, Recombinant (His)

Sign In for Pricing
View Details
Podoplanin Protein, Human, Recombinant (His)
TMPY-05801-04 50 µg

Podoplanin Protein, Human, Recombinant (His)

Sign In for Pricing
View Details
Podoplanin Protein, Human, Recombinant (His)
TMPY-05801-05 100 µg

Podoplanin Protein, Human, Recombinant (His)

Sign In for Pricing
View Details