Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lassa virus Pre-glycoprotein polyprotein GP complex (GPC), partial

Recombinant Lassa virus Pre-glycoprotein polyprotein GP complex (GPC), partial

Product Specifications

Product Name Alternative

Pre-GP-C; GPC; GP-C

UniProt

P08669

Expression Region

59-259aa

Tag

N-terminal 10xHis-tagged

Source

Yeast

Origin

Lassa virus (strain Mouse/Sierra Leone/Josiah/1976) (LASV)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TSLYKGVYELQTLELNMETLNMTMPLSCTKNNSHHYIMVGNETGLELTLTNTSIINHKFCNLSDAHKKNLYDHALMSIISTFHLSIPNFNQYEAMSCDFNGGKISVQYNLSHSYAGDAANHCGTVANGVLQTFMRMAWGGSYIALDSGRGNWDCIMTSYQYLIIQNTTWEDHCQFSRPSPIGYLGLLSQRTRDIYISRRLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MST4, Recombinant, Human, GST-Tag (MASK, RP6-213H19.1) discontinued
500285 10 µg

MST4, Recombinant, Human, GST-Tag (MASK, RP6-213H19.1) discontinued

Sign In for Pricing
View Details
PHEX, Rat, Control Peptide (PEX, Phosphate-regulating Gene with Homologies to Endopeptidases on the X Chromosome)
P4070-68C 100 µg

PHEX, Rat, Control Peptide (PEX, Phosphate-regulating Gene with Homologies to Endopeptidases on the X Chromosome)

Sign In for Pricing
View Details
Tissue, Array, Human Tumor, Different Types of Tumor, Multi, tissue VII (8), thyroid, control, adrenal, control, parotid, control, lymphoma, control (matched with Total RNA Northern Blot) (Paraffin)
MBS639541-01 5 Arrays

Tissue, Array, Human Tumor, Different Types of Tumor, Multi, tissue VII (8), thyroid, control, adrenal, control, parotid, control, lymphoma, control (matched with Total RNA Northern Blot) (Paraffin)

Sign In for Pricing
View Details
Tissue, Array, Human Tumor, Different Types of Tumor, Multi, tissue VII (8), thyroid, control, adrenal, control, parotid, control, lymphoma, control (matched with Total RNA Northern Blot) (Paraffin)
MBS639541-02 5x 5 Arrays

Tissue, Array, Human Tumor, Different Types of Tumor, Multi, tissue VII (8), thyroid, control, adrenal, control, parotid, control, lymphoma, control (matched with Total RNA Northern Blot) (Paraffin)

Sign In for Pricing
View Details
Anti-PF4 antibody
STJ119501 100 µl

Anti-PF4 antibody

Sign In for Pricing
View Details
KWE 3'UTR Lenti-reporter-Luc Vector
26237081 1.0 µg

KWE 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details