Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lassa virus Pre-glycoprotein polyprotein GP complex (GPC), partial

Recombinant Lassa virus Pre-glycoprotein polyprotein GP complex (GPC), partial

Product Specifications

Product Name Alternative

Pre-GP-C; GPC; GP-C

UniProt

P08669

Expression Region

59-259aa

Tag

N-terminal 10xHis-tagged

Source

Yeast

Origin

Lassa virus (strain Mouse/Sierra Leone/Josiah/1976) (LASV)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TSLYKGVYELQTLELNMETLNMTMPLSCTKNNSHHYIMVGNETGLELTLTNTSIINHKFCNLSDAHKKNLYDHALMSIISTFHLSIPNFNQYEAMSCDFNGGKISVQYNLSHSYAGDAANHCGTVANGVLQTFMRMAWGGSYIALDSGRGNWDCIMTSYQYLIIQNTTWEDHCQFSRPSPIGYLGLLSQRTRDIYISRRLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4- (Piperidin-4-yloxy) -benzonitrile hydrochloride salt
232679-01 250 mg

4- (Piperidin-4-yloxy) -benzonitrile hydrochloride salt

Sign In for Pricing
View Details
4- (Piperidin-4-yloxy) -benzonitrile hydrochloride salt
232679-02 1 g

4- (Piperidin-4-yloxy) -benzonitrile hydrochloride salt

Sign In for Pricing
View Details
4- (Piperidin-4-yloxy) -benzonitrile hydrochloride salt
232679-03 5 g

4- (Piperidin-4-yloxy) -benzonitrile hydrochloride salt

Sign In for Pricing
View Details
CBX8 CRISPR All-in-one AAV vector set (with saCas9)(Human)
15149151 3x 1.0 µg DNA

CBX8 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Dnmt2 (TRDMT1) Rabbit Polyclonal Antibody
TA346721 100 µL

Dnmt2 (TRDMT1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse Mitochondrial Uncoupling Protein 2 (UCP2)
RPU44289-01 50 µg

Recombinant Mouse Mitochondrial Uncoupling Protein 2 (UCP2)

Sign In for Pricing
View Details