Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Candida albicans Cell surface mannoprotein MP65 (MP65), partial

Recombinant Candida albicans Cell surface mannoprotein MP65 (MP65), partial

Product Specifications

Product Name Alternative

Mannoprotein of 65 kDa; Soluble cell wall protein 10

UniProt

Q59XX2

Expression Region

47-125aa

Tag

C-terminal 10xHis-tagged

Source

Yeast

Origin

Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

9.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IGNGDQTTTFAAPSVAAESSVSVSVNTEPPQNHPTTTQDVASASTYPSSTDGSAASSSAAASSSSQAGSEPSGGVGSGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-E2F3 Antibody Picoband
MBS1755177-01 0.01 mg

Anti-E2F3 Antibody Picoband

Sign In for Pricing
View Details
Anti-E2F3 Antibody Picoband
MBS1755177-02 0.1 mg (Carrier Free)

Anti-E2F3 Antibody Picoband

Sign In for Pricing
View Details
Anti-E2F3 Antibody Picoband
MBS1755177-03 0.1 mg

Anti-E2F3 Antibody Picoband

Sign In for Pricing
View Details
Anti-E2F3 Antibody Picoband
MBS1755177-04 0.1 mg (Cy3)

Anti-E2F3 Antibody Picoband

Sign In for Pricing
View Details
Anti-E2F3 Antibody Picoband
MBS1755177-05 0.1 mg (Biotin)

Anti-E2F3 Antibody Picoband

Sign In for Pricing
View Details
Anti-E2F3 Antibody Picoband
MBS1755177-06 0.1 mg (HRP)

Anti-E2F3 Antibody Picoband

Sign In for Pricing
View Details