Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-12 subunit beta (IL12B)

Recombinant Human Interleukin-12 subunit beta (IL12B)

Product Specifications

Product Name Alternative

Cytotoxic lymphocyte maturation factor 40 kDa subunit; IL-12 subunit p40; NK cell stimulatory factor chain 2

UniProt

P29460

Expression Region

23-328aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pcsk1n ORF Vector (Rat) (pORF)
36232016 1.0 µg DNA

Pcsk1n ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Pollen Allergen Phl P 11 Antibody
abx422508-01 100 µg

Pollen Allergen Phl P 11 Antibody

Sign In for Pricing
View Details
Pollen Allergen Phl P 11 Antibody
abx422508-02 1 mg

Pollen Allergen Phl P 11 Antibody

Sign In for Pricing
View Details
Olfactory receptor 2T2/35 rabbit pAb
ES3035-01 50 µL

Olfactory receptor 2T2/35 rabbit pAb

Sign In for Pricing
View Details
Olfactory receptor 2T2/35 rabbit pAb
ES3035-02 100 µL

Olfactory receptor 2T2/35 rabbit pAb

Sign In for Pricing
View Details
PHC1 Adenovirus (Mouse)
36547054 1.0 mL

PHC1 Adenovirus (Mouse)

Sign In for Pricing
View Details