Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-12 subunit beta (IL12B)

Recombinant Human Interleukin-12 subunit beta (IL12B)

Product Specifications

Product Name Alternative

Cytotoxic lymphocyte maturation factor 40 kDa subunit; IL-12 subunit p40; NK cell stimulatory factor chain 2

UniProt

P29460

Expression Region

23-328aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ICP Std Iron 100ug/mL in 2-5% HNO3 - 500ML
PFE1C3 500 mL

ICP Std Iron 100ug/mL in 2-5% HNO3 - 500ML

Sign In for Pricing
View Details
GSTA3 antibody
70R-2939 50 ug

GSTA3 antibody

Sign In for Pricing
View Details
ZEP Antibody
orb799068 2 mg

ZEP Antibody

Sign In for Pricing
View Details
5- (Bromomethyl) -2,3-dihydro-1,4-benzodioxine
OR1071992-01 100 mg

5- (Bromomethyl) -2,3-dihydro-1,4-benzodioxine

Sign In for Pricing
View Details
5- (Bromomethyl) -2,3-dihydro-1,4-benzodioxine
OR1071992-02 250 mg

5- (Bromomethyl) -2,3-dihydro-1,4-benzodioxine

Sign In for Pricing
View Details
5- (Bromomethyl) -2,3-dihydro-1,4-benzodioxine
OR1071992-03 1 g

5- (Bromomethyl) -2,3-dihydro-1,4-benzodioxine

Sign In for Pricing
View Details