Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Growth-regulated alpha protein (CXCL1)

Recombinant Human Growth-regulated alpha protein (CXCL1)

Product Specifications

Product Name Alternative

C-X-C motif chemokine 1; GRO-alpha (1-73) ; Melanoma growth stimulatory activity; Neutrophil-activating protein 3

UniProt

P09341

Expression Region

35-107aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

9.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat IL-23 ELISA Kit
ELA-E0384r 96 Tests

Rat IL-23 ELISA Kit

Sign In for Pricing
View Details
ApolipoProtein E/APOE4 His Tag Protein, Human
UA030062-01 50 µg

ApolipoProtein E/APOE4 His Tag Protein, Human

Sign In for Pricing
View Details
ApolipoProtein E/APOE4 His Tag Protein, Human
UA030062-02 100 µg

ApolipoProtein E/APOE4 His Tag Protein, Human

Sign In for Pricing
View Details
OR2AJ1 CRISPRa sgRNA lentivector (set of three targets)(Human)
35044121 3x 1.0µg DNA

OR2AJ1 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
3,4-Diaminobenzoic acid
abx181863-01 25 g

3,4-Diaminobenzoic acid

Sign In for Pricing
View Details
3,4-Diaminobenzoic acid
abx181863-02 100 g

3,4-Diaminobenzoic acid

Sign In for Pricing
View Details