Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Growth-regulated alpha protein (CXCL1)

Recombinant Human Growth-regulated alpha protein (CXCL1)

Product Specifications

Product Name Alternative

C-X-C motif chemokine 1; GRO-alpha (1-73) ; Melanoma growth stimulatory activity; Neutrophil-activating protein 3

UniProt

P09341

Expression Region

35-107aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

9.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIA1 CRISPR Knock Out 293T Cell Line (Human)
46685141 1x 10^6 Cells / 1.0 mL

TIA1 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Ntf5-set siRNA/shRNA/RNAi Lentivector (Mouse)
32237094 4x 500 ng

Ntf5-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Rifampicin (≥97%, Reagent grade)
ST1632-5g 5 g

Rifampicin (≥97%, Reagent grade)

Sign In for Pricing
View Details
VITRN Antibody Blocking peptide
orb1460276 500 µg

VITRN Antibody Blocking peptide

Sign In for Pricing
View Details
Vimentin (VIM) Biotinylated Mouse Monoclonal Detection Antibody (Biotin conjugated) [Clone ID: OTI5C10]
TA700391 50 µg

Vimentin (VIM) Biotinylated Mouse Monoclonal Detection Antibody (Biotin conjugated) [Clone ID: OTI5C10]

Sign In for Pricing
View Details
Carcinoembryonic Antigen (CEA) / CD66 (rC66/1009), 0.2mg/mL
BNUB2054-500 1x 500 µL

Carcinoembryonic Antigen (CEA) / CD66 (rC66/1009), 0.2mg/mL

Sign In for Pricing
View Details