Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Focal adhesion kinase 1 (Ptk2), partial

Recombinant Mouse Focal adhesion kinase 1 (Ptk2), partial

Product Specifications

Product Name Alternative

Focal adhesion kinase-related nonkinase; Protein-tyrosine kinase 2; p125FAK; pp125FAK

UniProt

P34152

Expression Region

685-1052aa

Tag

N-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VQQEERMRMESRRQATVSWDSGGSDEAPPKPSRPGYPSPRSSEGFYPSPQHMVQTNHYQVSGYPGSHGIPAMAGSIYQGQASLLDQTELWNHRPQEMSMWQPSVEDSAALDLRGMGQVLPPHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLSRGSIDREDGSFQGPTGNQHIYQPVGKPDPAAPPKKPPRPGAPGHLSNLSSISSPADSYNEGVKLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPALPASTHREIEMAQKLLNSDLGELISKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQTRPH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

D-threo-Ethylphenidate Hydrochloride
TRC-E925635-5MG 5 mg

D-threo-Ethylphenidate Hydrochloride

Sign In for Pricing
View Details
Rhox2a Mouse Gene Knockout Kit (CRISPR)
KN514784 1 Kit

Rhox2a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Biotin Conjugated Rat IFN gamma Recombinant Rabbit Monoclonal Antibody [PS01-97] - BSA and Azide free (Detector)
HA721620 100 µL

Biotin Conjugated Rat IFN gamma Recombinant Rabbit Monoclonal Antibody [PS01-97] - BSA and Azide free (Detector)

Sign In for Pricing
View Details
Vinculin (VCL) Rabbit Polyclonal Antibody
AP06605PU-N 100 µg

Vinculin (VCL) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
VLDL Receptor (VLDLR) (NM_003383) Human Over-expression Lysate
LC401153 20 µg

VLDL Receptor (VLDLR) (NM_003383) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lymphoid tissue
CB632329 1 Block

Frozen Tissue Blocks, Lymphoid tissue

Sign In for Pricing
View Details