Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Early activation antigen CD69 (CD69), partial

Recombinant Human Early activation antigen CD69 (CD69), partial

Product Specifications

Product Name Alternative

Activation inducer molecule; BL-AC/P26; C-type lectin domain family 2 member C; EA1; Early T-cell activation antigen p60; GP32/28; Leukocyte surface antigen Leu-23; MLR-3

UniProt

Q07108

Expression Region

62-199aa

Tag

C-terminal mFc2a-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SVGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Telaglenastat hydrochloride
orb1691412 5 mg

Telaglenastat hydrochloride

Sign In for Pricing
View Details
Pdcd6 Rat siRNA Oligo Duplex (Locus ID 308061)
SR512856 1 Kit

Pdcd6 Rat siRNA Oligo Duplex (Locus ID 308061)

Sign In for Pricing
View Details
TUSC4 antibody - middle region (ARP50540_P050)
ARP50540_P050 100 µL

TUSC4 antibody - middle region (ARP50540_P050)

Sign In for Pricing
View Details
IL-11 (human), (recombinant)
MBS567242-01 0.01 mg

IL-11 (human), (recombinant)

Sign In for Pricing
View Details
IL-11 (human), (recombinant)
MBS567242-02 5x 0.01 mg

IL-11 (human), (recombinant)

Sign In for Pricing
View Details
Rabbit Polyclonal DRIL1 Antibody [Biotin]
NBP2-98981B 0.1 mL

Rabbit Polyclonal DRIL1 Antibody [Biotin]

Sign In for Pricing
View Details