Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Early activation antigen CD69 (CD69), partial

Recombinant Human Early activation antigen CD69 (CD69), partial

Product Specifications

Product Name Alternative

Activation inducer molecule; BL-AC/P26; C-type lectin domain family 2 member C; EA1; Early T-cell activation antigen p60; GP32/28; Leukocyte surface antigen Leu-23; MLR-3

UniProt

Q07108

Expression Region

62-199aa

Tag

C-terminal mFc2a-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SVGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Bromo-3- (2,3-dihydro-1H-indole-1-sulfonyl) benzoic acid
TBB26132-01 0.5 g

4-Bromo-3- (2,3-dihydro-1H-indole-1-sulfonyl) benzoic acid

Sign In for Pricing
View Details
4-Bromo-3- (2,3-dihydro-1H-indole-1-sulfonyl) benzoic acid
TBB26132-02 5 g

4-Bromo-3- (2,3-dihydro-1H-indole-1-sulfonyl) benzoic acid

Sign In for Pricing
View Details
ID2 (Inhibitor of DNA Binding 2, Dominant Negative Helix-loop-Helix Protein, GIG8, ID2A, ID2H, MGC26389, bHLHb26) (MaxLight 550)
247370-ML550 100 µL

ID2 (Inhibitor of DNA Binding 2, Dominant Negative Helix-loop-Helix Protein, GIG8, ID2A, ID2H, MGC26389, bHLHb26) (MaxLight 550)

Sign In for Pricing
View Details
Human Monoclonal ENPP-3/CD203c Antibody (Ags-16C3F) [Janelia Fluor 525]
NBP3-28126JF525 0.1 mL

Human Monoclonal ENPP-3/CD203c Antibody (Ags-16C3F) [Janelia Fluor 525]

Sign In for Pricing
View Details
Bovine family with sequence similarity 72, member A ELISA Kit
OM622376 96 Strip Well

Bovine family with sequence similarity 72, member A ELISA Kit

Sign In for Pricing
View Details
NLN Protein (N-His, Human)
P527102 100 µg

NLN Protein (N-His, Human)

Sign In for Pricing
View Details