Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta Epithelial cell adhesion molecule (TACSTD1), partial, Biotinylated

Recombinant Macaca mulatta Epithelial cell adhesion molecule (TACSTD1), partial, Biotinylated

Product Specifications

Product Name Alternative

Tumor-associated calcium signal transducer 1

UniProt

Q1WER1

Expression Region

24-265aa

Tag

C-terminal 10xHis-G4S-Avi-tagged

Source

Mammalian cell

Origin

Macaca mulatta (Rhesus macaque)

Field of Research

Immunology & Inflammation; Cell Biology

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QKECVCENYKLAVNCFLNDNGQCQCTSIGAQNTVLCSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSTCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDVQSLRTALEEAIKTRYQLDPKFITNILYEDNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLRVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zc3h18 ORF Vector (Mouse) (pORF)
50744014 1.0 µg DNA

Zc3h18 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
(±) -trans-ACPD
M17567-01 1 g

(±) -trans-ACPD

Sign In for Pricing
View Details
(±) -trans-ACPD
M17567-02 200 mg

(±) -trans-ACPD

Sign In for Pricing
View Details
(±) -trans-ACPD
M17567-03 500 mg

(±) -trans-ACPD

Sign In for Pricing
View Details
(±) -trans-ACPD
M17567-04 2 mg

(±) -trans-ACPD

Sign In for Pricing
View Details
(±) -trans-ACPD
M17567-05 5 mg

(±) -trans-ACPD

Sign In for Pricing
View Details