Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Eukaryotic translation initiation factor 1A, Y-chromosomal (EIF1AY)

Recombinant Human Eukaryotic translation initiation factor 1A, Y-chromosomal (EIF1AY)

Product Specifications

Product Name Alternative

Eukaryotic translation initiation factor 4C

UniProt

O14602

Expression Region

2-144aa

Tag

N-terminal GST-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Kidney
CS710354 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
PPIL5 (LRR1) Human qPCR Primer Pair (NM_152329)
HP217613 200 Reactions

PPIL5 (LRR1) Human qPCR Primer Pair (NM_152329)

Sign In for Pricing
View Details
IGLON5 Human Gene Knockout Kit (CRISPR)
KN425495 1 Kit

IGLON5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Skin
CS619881 5x 5 µm

Frozen Tissue Sections, Skin

Sign In for Pricing
View Details
Trk B (Ab-705) Antibody
8B0036-AAT 50 µg

Trk B (Ab-705) Antibody

Sign In for Pricing
View Details
Delta-Tocotrienol
TRC-T526195-10MG 10 mg

Delta-Tocotrienol

Sign In for Pricing
View Details