Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CDGSH iron-sulfur domain-containing protein 3, mitochondrial (CISD3)

Recombinant Human CDGSH iron-sulfur domain-containing protein 3, mitochondrial (CISD3)

Product Specifications

Product Name Alternative

MitoNEET-related protein 2; Mitochondrial inner NEET protein

UniProt

P0C7P0

Expression Region

15-127aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ARDLNPRRDISSWLAQWFPRTPARSVVALKTPIKVELVAGKTYRWCVCGRSKKQPFCDGSHFFQRTGLSPLKFKAQETRMVALCTCKATQRPPYCDGTHRSERVQKAEVGSPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pmel17 / gp100 / SILV (NKI-beteb), CF405S conjugate, 0.1mg/mL
BNC040226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF568 conjugate, 0.1mg/mL
BNC680338-100 1x 100 µL

P53 (PAb122), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF740 conjugate, 0.1mg/mL
BNC740276-500 1x 500 µL

TAG-72 / CA72.4 (B72.3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF568 conjugate, 0.1mg/mL
BNC680181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (C3e/2478), CF647 conjugate, 0.1mg/mL
BNC472478-500 1x 500 µL

CD3e (T-Cell Marker) (C3e/2478), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Neurofilament (NF-L) (NR-4), CF488A conjugate, 0.1mg/mL
BNC880303-100 1x 100 µL

Neurofilament (NF-L) (NR-4), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details