Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Estrogen receptor (ESR1), partial

Recombinant Human Estrogen receptor (ESR1), partial

Product Specifications

Product Name Alternative

ER-alpha; Estradiol receptor; Nuclear receptor subfamily 3 group A member 1

UniProt

P03372

Expression Region

89-230aa

Tag

N-terminal 6xHis-ABP-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTID

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GATA3 (Ab-308) Antibody
8B0933-AAT 50 µg

GATA3 (Ab-308) Antibody

Sign In for Pricing
View Details
Desmin (DES) (NM_001927) Human Over-expression Lysate
LC400713 20 µg

Desmin (DES) (NM_001927) Human Over-expression Lysate

Sign In for Pricing
View Details
FGFBP1 Rabbit Polyclonal Antibody
TA371789 100 µL

FGFBP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
POTEE (NM_001083538) Human Over-expression Lysate
LC421218 20 µg

POTEE (NM_001083538) Human Over-expression Lysate

Sign In for Pricing
View Details
Crotonaldehyde Antibody: ATTO 594
SMC-534D-A594 100 µg

Crotonaldehyde Antibody: ATTO 594

Sign In for Pricing
View Details
UBAC1
Y158455 100 µL

UBAC1

Sign In for Pricing
View Details