Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Progesterone receptor (PGR), partial

Recombinant Human Progesterone receptor (PGR), partial

Product Specifications

Product Name Alternative

Nuclear receptor subfamily 3 group C member 3; PR

UniProt

P06401

Expression Region

323-419aa

Tag

N-terminal 6xHis-ABP-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology; Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LLEDESYDGGAGAASAFAPPRSSPCASSTPVAVGDFPDCAYPPDAEPKDDAYPLYSDFQPPALKIKEEEEGAEASARSPRSYLVAGANPAAFPDFPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FA2H Human Gene Knockout Kit (CRISPR)
KN402093 1 Kit

FA2H Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin 7 (K72.7), Biotin conjugate, 0.1mg/mL
BNCB0757-100 1x 100 µL

Cytokeratin 7 (K72.7), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS626733 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/2580), 0.2mg/mL
BNUB2580-100 1x 100 µL

CD10 (Membrane Metalloendopeptidase) (MME/2580), 0.2mg/mL

Sign In for Pricing
View Details
CD47 (23-140) Rabbit Polyclonal Antibody
AP33397PU-N 50 µg

CD47 (23-140) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Salivary gland
CS803450 5x 5 µm

Tissue FFPE Sections, Salivary gland

Sign In for Pricing
View Details