Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Progesterone receptor (PGR), partial

Recombinant Human Progesterone receptor (PGR), partial

Product Specifications

Product Name Alternative

Nuclear receptor subfamily 3 group C member 3; PR

UniProt

P06401

Expression Region

323-419aa

Tag

N-terminal 6xHis-ABP-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology; Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LLEDESYDGGAGAASAFAPPRSSPCASSTPVAVGDFPDCAYPPDAEPKDDAYPLYSDFQPPALKIKEEEEGAEASARSPRSYLVAGANPAAFPDFPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat IgG1 Isotype Control (Clone: HRPN)
10-105-100 100 µg

Rat IgG1 Isotype Control (Clone: HRPN)

Sign In for Pricing
View Details
Pentanoic-3,3-d2 Acid
TRC-V091421-10MG 10 mg

Pentanoic-3,3-d2 Acid

Sign In for Pricing
View Details
MASP1 Antibody
KC-3151-01 50 μL

MASP1 Antibody

Sign In for Pricing
View Details
MASP1 Antibody
KC-3151-02 100 µL

MASP1 Antibody

Sign In for Pricing
View Details
MASP1 Antibody
KC-3151-03 1 mL

MASP1 Antibody

Sign In for Pricing
View Details
CCM2 Rabbit Polyclonal Antibody
TA374361 100 µL

CCM2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details