Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cell migration-inducing and hyaluronan-binding protein (CEMIP), partial

Recombinant Human Cell migration-inducing and hyaluronan-binding protein (CEMIP), partial

Product Specifications

Product Name Alternative

Hyaluronan binding protein involved in hyaluronan depolymerization

UniProt

Q8WUJ3

Expression Region

881-980aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YDGPINIQNCTFRKFVALEGRHTSALAFRLNNAWQSCPHNNVTGIAFEDVPITSRVFFGEPGPWFNQLDMDGDKTSVFHDVDGSVSEYPGSYLTKNDNWL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCAR1 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
15158156 3x 1.0 µg DNA

CCAR1 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
C9orf93 AAV siRNA Pooled Vector
53910161 1.0 µg

C9orf93 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Inpp5f sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3863108 1.0 µg DNA

Inpp5f sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Brilliant Violet 785™ anti-human CD146
GT14263 100 Tests

Brilliant Violet 785™ anti-human CD146

Sign In for Pricing
View Details
Anti-MMTAG2 Antibody Picoband®
A14711-1 100 µg/Vial

Anti-MMTAG2 Antibody Picoband®

Sign In for Pricing
View Details
KLHL6 Protein Vector (Mouse) (pPB-N-His)
PV194751 500 ng

KLHL6 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details