Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cell migration-inducing and hyaluronan-binding protein (CEMIP), partial

Recombinant Human Cell migration-inducing and hyaluronan-binding protein (CEMIP), partial

Product Specifications

Product Name Alternative

Hyaluronan binding protein involved in hyaluronan depolymerization

UniProt

Q8WUJ3

Expression Region

881-980aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YDGPINIQNCTFRKFVALEGRHTSALAFRLNNAWQSCPHNNVTGIAFEDVPITSRVFFGEPGPWFNQLDMDGDKTSVFHDVDGSVSEYPGSYLTKNDNWL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPINT1, ID (SPINT1, HAI1, Kunitz-type protease inhibitor 1, Hepatocyte growth factor activator inhibitor type 1)
MBS6008478-01 0.2 mL

SPINT1, ID (SPINT1, HAI1, Kunitz-type protease inhibitor 1, Hepatocyte growth factor activator inhibitor type 1)

Sign In for Pricing
View Details
SPINT1, ID (SPINT1, HAI1, Kunitz-type protease inhibitor 1, Hepatocyte growth factor activator inhibitor type 1)
MBS6008478-02 5x 0.2 mL

SPINT1, ID (SPINT1, HAI1, Kunitz-type protease inhibitor 1, Hepatocyte growth factor activator inhibitor type 1)

Sign In for Pricing
View Details
Mouse Monoclonal Mast Cell Marker Antibody (MCG35) [PE]
NBP2-50484PE 0.1 mL

Mouse Monoclonal Mast Cell Marker Antibody (MCG35) [PE]

Sign In for Pricing
View Details
Human Folic acid (FA) ELISA Kit
orb1671013 96 Tests

Human Folic acid (FA) ELISA Kit

Sign In for Pricing
View Details
PERP TP53 apoptosis effector (PERP) polyclonal antibody
ABP-PAB-10284 100 ug

PERP TP53 apoptosis effector (PERP) polyclonal antibody

Sign In for Pricing
View Details
Anxa11 Rabbit Polyclonal Antibody (HRP)
orb2131647 100 µL

Anxa11 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details